[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_02911

[Show Plain Result]


## Summary of Sequence Search
    1::537
    3::64      2e-07  34%  715 aa  YJB1_SCHPO RecName: Full=Uncharacterized protein C553.01c;
 1244::1364    2e-04  37% 5005 aa  K1109_HUMAN RecName: Full=Uncharacterized protein KIAA1109;AltName:
  982::1082    7e-04  28% 1183 aa  INP52_YEAST RecName: Full=Inositol-1,4,5-trisphosphate 5-phosphatase
    1::537

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxTTAAVIRFSCLFTYDIKRKAKRWQDGFLRFHTFNRRVMVYGTSGDFVGDLH
YJB1_SCHPO      -------------------TSSNVFHYQVLWTSDKAKKVKVWKDGTMRFHSFNNRGILYDSDNRVVDDFF
K1109_HUMAN     ----------------------------------------------------------------------
INP52_YEAST     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MRESSTVRDGDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YJB1_SCHPO      LNNKRIVLDSE-----------------------------------------------------------
K1109_HUMAN     ----------------------------------------------------------------------
INP52_YEAST     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPVVERQREGDASIASK
YJB1_SCHPO      ----------------------------------------------------------------------
K1109_HUMAN     ------------------------------------------------------PLLAGEKESPSSVADD
INP52_YEAST     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NLERISARKINDGGSTGINLASTTKPNQNDTSGGFQPASALKITSSSRAEHGRKGSKKALLGNQKAITAM
YJB1_SCHPO      ----------------------------------------------------------------------
K1109_HUMAN     HLEFLHGTKRDDGQATEISGNSPVSPNTQDKSVGQSPLSPLKRQASVCSTR---------LGSTKSLTAA
INP52_YEAST     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FHGDKRNITFPSPVENPRKKLMCLEISKKPKTGKKPAQRESTGSxxxxxxxxxxxxxxxxxxxxxxxxxx
YJB1_SCHPO      ----------------------------------------------------------------------
K1109_HUMAN     FYGDKQPVTFSSDVSRSDENVL-----------DSPKQRRSFGS--------------------------
INP52_YEAST     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxKMAVLTPTGGNSPMDYIPSTSTMRVLEESFHVSEAPPSPQKATRSISDFFKPNPPPPAIQEEKEN
YJB1_SCHPO      ----------------------------------------------------------------------
K1109_HUMAN     ----------------------------------------------------------------------
INP52_YEAST     -----KLNVLPPPPPTSRHNKEPSSKLLSPTKEISIVSVSPRKGESNLPALERHSKPLPPVPAL------


                         .         .         +         .         .         .         .:490
query           TGSSPKPPSLLRSHSDIEALAQPTESTTLLSNPAPPHRHRTAxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YJB1_SCHPO      ----------------------------------------------------------------------
K1109_HUMAN     ----------------------------------------------------------------------
INP52_YEAST     --SLSKPVSLQKSSSELQHAKETIDNGKIVPRPCPPIRRKSS----------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YJB1_SCHPO      -----------------------------------------------
K1109_HUMAN     -----------------------------------------------
INP52_YEAST     -----------------------------------------------