[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_02920

[Show Plain Result]


## Summary of Sequence Search
    1::1547
   15::1676    e-159  47% 1676 aa  APSA_EMENI RecName: Full=Anucleate primary sterigmata protein A;
 2564::2700    6e-31  50% 2748 aa  NUM1_YEAST RecName: Full=Nuclear migration protein NUM1;
  541::965     1e-10  22% 2022 aa  ANT1_ONCVO RecName: Full=Major antigen;AltName: Full=Myosin-like
  848::1073    2e-07  26% 1969 aa  MYO3_CAEBR RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain A;
   38::214     3e-07  25% 1102 aa  MYSC_CHICK RecName: Full=Myosin heavy chain, cardiac muscle
   31::254     3e-07  30%  968 aa  MCP5_SCHPO RecName: Full=Meiotic coiled-coil protein 5;AltName:
  595::897     7e-07  24% 1387 aa  KI15B_XENLA RecName: Full=Kinesin-like protein KIF15-B;AltName:
  980::1183    9e-07  32% 3210 aa  CENPF_HUMAN RecName: Full=Centromere protein F;AltName:
  414::647     1e-06  27% 1416 aa  UACA_HUMAN RecName: Full=Uveal autoantigen with coiled-coil domains
  451::832     1e-06  23% 1101 aa  CC150_HUMAN RecName: Full=Coiled-coil domain-containing protein
  668::960     2e-06  25% 1679 aa  MLP2_YEAST RecName: Full=Protein MLP2;AltName: Full=Myosin-like
  304::415     2e-06  34% 1157 aa  JIP_CAEEL RecName: Full=JNK-interacting protein;       
  216::338     2e-06  29%  578 aa  CC155_MOUSE RecName: Full=Coiled-coil domain-containing protein
  216::352     2e-06  27%  562 aa  CC155_HUMAN RecName: Full=Coiled-coil domain-containing protein
  558::717     3e-06  28% 1161 aa  CING_DANRE RecName: Full=Cingulin;
  746::918     3e-06  32% 1581 aa  ANR26_MOUSE RecName: Full=Ankyrin repeat domain-containing protein
  343::488     4e-06  30%  699 aa  UN84B_MOUSE RecName: Full=Protein unc-84 homolog B;AltName:
  848::1023    4e-06  29% 1969 aa  MYO3_CAEEL RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain A;
  191::333     4e-06  30%  525 aa  CC155_BOVIN RecName: Full=Coiled-coil domain-containing protein
 1220::1510    4e-06  24% 2611 aa  BPAEA_MOUSE RecName: Full=Bullous pemphigoid antigen 1, isoform 5;   
 1043::1223    7e-06  29% 2009 aa  CROCC_MOUSE RecName: Full=Rootletin;AltName: Full=Ciliary rootlet
  872::1048    1e-05  24% 1935 aa  MYH7_MOUSE RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
  872::1048    1e-05  24% 1935 aa  MYH7_CANFA RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1229::1526    1e-05  22% 1774 aa  KI20B_MOUSE RecName: Full=Kinesin-like protein KIF20B;AltName:
  250::450     2e-05  28%  638 aa  MYSP_OPIFE RecName: Full=Paramyosin;Flags: Fragment;
  872::1048    2e-05  24% 1935 aa  MYH7_PIG RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
  872::1048    2e-05  24% 1935 aa  MYH7_HORSE RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
  872::1048    2e-05  24% 1935 aa  MYH7_BOVIN RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1241::1449    2e-05  26% 2363 aa  TPR_HUMAN RecName: Full=Nucleoprotein TPR;
 1188::1390    2e-05  30% 1947 aa  MYO2_CAEEL RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain C;
  872::1048    2e-05  23% 1935 aa  MYH7_RAT RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
  339::445     2e-05  33%  624 aa  MOEH_ANOGA RecName: Full=Moesin/ezrin/radixin homolog 1;
  189::501     2e-05  25%  767 aa  GOGA1_HUMAN RecName: Full=Golgin subfamily A member 1;AltName:
  409::561     2e-05  22%  864 aa  EP15R_HUMAN RecName: Full=Epidermal growth factor receptor
  306::660     3e-05  28%  857 aa  MEDB_GIALA RecName: Full=Median body protein;
  493::760     3e-05  22% 1140 aa  CP135_HUMAN RecName: Full=Centrosomal protein of 135 kDa;       
  770::901     4e-05  25% 1388 aa  KI15A_XENLA RecName: Full=Kinesin-like protein KIF15-A;AltName:
  874::1050    5e-05  22% 1938 aa  MYH6_MOUSE RecName: Full=Myosin-6;AltName: Full=Myosin heavy chain
  286::533     5e-05  24% 1257 aa  LIPA2_MOUSE RecName: Full=Liprin-alpha-2;AltName: Full=Protein
  353::609     5e-05  27%  960 aa  KIF23_HUMAN RecName: Full=Kinesin-like protein KIF23;AltName:
   82::212     5e-05  24% 1818 aa  HMW2_MYCPN RecName: Full=Cytadherence high molecular weight protein
  456::598     5e-05  30%  986 aa  GOGA2_RAT RecName: Full=Golgin subfamily A member 2;AltName:
  407::559     5e-05  22%  907 aa  EP15R_MOUSE RecName: Full=Epidermal growth factor receptor
   11::274     5e-05  20%  471 aa  C117B_DANRE RecName: Full=Uncharacterized protein C9orf117 homolog
  871::1047    6e-05  22% 1934 aa  MYH7_MESAU RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
  873::1049    6e-05  22% 1938 aa  MYH6_RAT RecName: Full=Myosin-6;AltName: Full=Myosin heavy chain
  874::1050    6e-05  22% 1939 aa  MYH6_MESAU RecName: Full=Myosin-6;AltName: Full=Myosin heavy chain
  517::746     6e-05  21% 1713 aa  MRCKB_RAT RecName: Full=Serine/threonine-protein kinase MRCK beta; 
  657::800     6e-05  29% 1873 aa  GRDN_MOUSE RecName: Full=Girdin;AltName: Full=Girders of actin
  568::723     6e-05  28% 1046 aa  CLIP2_HUMAN RecName: Full=CAP-Gly domain-containing linker protein
  816::945     6e-05  25% 1709 aa  ANR26_HUMAN RecName: Full=Ankyrin repeat domain-containing protein
  326::610     8e-05  26%  822 aa  ODFP2_CHICK RecName: Full=Outer dense fiber protein 2;AltName:
  306::601     8e-05  24%  691 aa  BRE1_DEBHA RecName: Full=E3 ubiquitin-protein ligase BRE1;       
   80::333     1e-04  27%  707 aa  SGM1_YEAST RecName: Full=Protein SGM1;AltName: Full=Slow growth on
  875::1051    1e-04  23% 1937 aa  MYH8_HUMAN RecName: Full=Myosin-8;AltName: Full=Myosin heavy chain
   69::245     1e-04  23%  465 aa  MYH6_RABIT RecName: Full=Myosin-6;AltName: Full=Myosin heavy chain
 1234::1373    1e-04  26% 1979 aa  MYH11_CHICK RecName: Full=Myosin-11;AltName: Full=Myosin heavy chain
   83::219     1e-04  33%  665 aa  LMNA_XENLA RecName: Full=Lamin-A;
  298::439     1e-04  31%  465 aa  K1C13_PROAT RecName: Full=Keratin, type I cytoskeletal 13;AltName:
  872::1048    1e-04  23% 1935 aa  MYH7_HUMAN RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
  123::290     1e-04  23% 1110 aa  CC150_MOUSE RecName: Full=Coiled-coil domain-containing protein
 1814::2150    1e-04  24% 3214 aa  BPA1_HUMAN RecName: Full=Bullous pemphigoid antigen 1, isoforms
  627::796     1e-04  22%  905 aa  ATG23_DEBHA RecName: Full=Autophagy-related protein 23;
  686::864     1e-04  26% 1337 aa  ATG11_MAGGR RecName: Full=Autophagy-related protein 11;
  617::787     2e-04  35% 1130 aa  TG278_CAEEL RecName: Full=Putative protein tag-278;
  880::1049    2e-04  21% 1935 aa  MYSS_CYPCA RecName: Full=Myosin heavy chain, fast skeletal muscle;
 1931::2109    2e-04  28% 2116 aa  MYS2_DICDI RecName: Full=Myosin-2 heavy chain;AltName: Full=Myosin II
  972::1120    2e-04  23% 1251 aa  CING_XENTR RecName: Full=Cingulin;
  722::853     2e-04  27% 1427 aa  C144A_HUMAN RecName: Full=Coiled-coil domain-containing protein
  919::1228    2e-04  25% 1957 aa  SPO15_SCHPO RecName: Full=Sporulation-specific protein 15;
  136::394     2e-04  26%  485 aa  K1C14_RAT RecName: Full=Keratin, type I cytoskeletal 14;AltName:
  255::428     2e-04  35%  691 aa  HOOK_CULQU RecName: Full=Protein hook;
   16::143     2e-04  29%  365 aa  GFAP_CARAU RecName: Full=Glial fibrillary acidic protein;Flags:
  491::703     2e-04  26% 1118 aa  CYTSA_CHICK RecName: Full=Cytospin-A;AltName: Full=SPECC1-like
   44::207     2e-04  25%  519 aa  CNPD1_PEDPA RecName: Full=2',3'-cyclic-nucleotide
 1627::1733    2e-04  27% 5171 aa  BPAEA_HUMAN RecName: Full=Bullous pemphigoid antigen 1, isoforms
  399::692     3e-04  25% 1401 aa  UACA_BOVIN RecName: Full=Uveal autoantigen with coiled-coil domains
  274::365     3e-04  27%  993 aa  SYCP1_MOUSE RecName: Full=Synaptonemal complex protein 1;       
   74::243     3e-04  23%  450 aa  IFEB_HELPO RecName: Full=Non-neuronal cytoplasmic intermediate
  216::336     3e-04  29%  396 aa  ICR5_ARATH RecName: Full=Interactor of constitutive active ROPs 5;
  479::636     3e-04  28%  794 aa  EVI5L_HUMAN RecName: Full=EVI5-like protein;AltName: Full=Ecotropic
  114::295     3e-04  25%  643 aa  CTK2_XENLA RecName: Full=Carboxy-terminal kinesin 2;AltName:
  830::1104    3e-04  26% 1153 aa  CING_SORAR RecName: Full=Cingulin;
  260::415     4e-04  27% 1500 aa  SSP5_STRGN RecName: Full=Agglutinin receptor;AltName:
11497::11693   4e-04  32% 22152 aa  MUC16_HUMAN RecName: Full=Mucin-16;         Short=MUC-16;AltName:
 2246::2591    4e-04  22% 9439 aa  EBH_STAES RecName: Full=Extracellular matrix-binding protein
 2246::2591    4e-04  22% 9439 aa  EBH_STAEQ RecName: Full=Extracellular matrix-binding protein
  553::760     4e-04  26% 1094 aa  CN145_HUMAN RecName: Full=Uncharacterized protein C14orf145;
   11::218     4e-04  22%  471 aa  C117A_DANRE RecName: Full=Uncharacterized protein C9orf117 homolog
  413::635     5e-04  22% 1415 aa  UACA_CANFA RecName: Full=Uveal autoantigen with coiled-coil domains
 1385::1673    5e-04  24% 1955 aa  PUMA_PARUN RecName: Full=227 kDa spindle- and centromere-associated
  117::231     5e-04  28%  866 aa  MYSP_SCHJA RecName: Full=Paramyosin;AltName: Full=Antigen Sj97;
  878::1054    5e-04  22% 1941 aa  MYH2_HUMAN RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain
  877::1053    5e-04  22% 1940 aa  MYH2_CANFA RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain
  334::447     5e-04  29%  572 aa  MOEH_CULQU RecName: Full=Moesin/ezrin/radixin homolog 1;
 1308::1641    5e-04  24% 1922 aa  KIF4_DICDI RecName: Full=Kinesin-related protein 4;AltName:
  250::557     5e-04  26%  712 aa  GOGC3_ARATH RecName: Full=Golgin candidate 3;       
  490::702     5e-04  22% 1117 aa  CYTSA_PANTR RecName: Full=Cytospin-A;AltName: Full=SPECC1-like
  490::702     5e-04  22% 1117 aa  CYTSA_HUMAN RecName: Full=Cytospin-A;AltName: Full=SPECC1-like
  742::890     5e-04  21% 2055 aa  CTRO_MOUSE RecName: Full=Citron Rho-interacting kinase;       
  501::760     5e-04  21% 1140 aa  CP135_MOUSE RecName: Full=Centrosomal protein of 135 kDa;       
  882::1113    5e-04  25% 1433 aa  CLIP1_CHICK RecName: Full=CAP-Gly domain-containing linker protein
   63::216     5e-04  30%  483 aa  CE57R_XENTR RecName: Full=Cep57-related protein;       
  464::632     7e-04  32% 1979 aa  TRIPB_HUMAN RecName: Full=Thyroid receptor-interacting protein 11; 
 1138::1254    7e-04  31% 1343 aa  SYGP1_HUMAN RecName: Full=Ras GTPase-activating protein
 1282::1480    7e-04  26% 1509 aa  MYSN_ACACA RecName: Full=Myosin-2 heavy chain, non muscle;AltName:
 1109::1564    7e-04  24% 2171 aa  MDC1_PANTR RecName: Full=Mediator of DNA damage checkpoint protein 1;
  254::525     7e-04  26% 1202 aa  LIPA1_HUMAN RecName: Full=Liprin-alpha-1;AltName: Full=Protein
  201::473     7e-04  26%  817 aa  KLP2_SCHPO RecName: Full=Kinesin-like protein 2;
  241::564     7e-04  23% 1679 aa  GCC2_MOUSE RecName: Full=GRIP and coiled-coil domain-containing
  491::703     7e-04  22% 1118 aa  CYTSA_MOUSE RecName: Full=Cytospin-A;AltName: Full=SPECC1-like
  501::778     7e-04  26% 1132 aa  CYTSA_DANRE RecName: Full=Cytospin-A-A;AltName: Full=SPECC1-like
 2000::2156    7e-04  30% 2325 aa  CP110_HUMAN RecName: Full=Centriolin;AltName: Full=110 kDa
  662::847     7e-04  22%  907 aa  CIP2A_MOUSE RecName: Full=Protein CIP2A;AltName: Full=Cancerous
  488::573     7e-04  29%  646 aa  CEP72_MOUSE RecName: Full=Centrosomal protein of 72 kDa;       
  546::675     7e-04  35% 1395 aa  AGLZ_MYXXD RecName: Full=Adventurous-gliding motility protein Z;
  855::979     9e-04  26% 1418 aa  SMC4_YEAST RecName: Full=Structural maintenance of chromosomes
  109::427     9e-04  24% 1388 aa  RGAG1_HUMAN RecName: Full=Retrotransposon gag domain-containing
    5::114     9e-04  29%  718 aa  PRAM_HUMAN RecName: Full=PML-RARA-regulated adapter molecule 1;      
  101::247     9e-04  28%  694 aa  PHR4A_XENLA RecName: Full=Phosphatase and actin regulator 4-A;
  335::626     9e-04  24%  991 aa  MPP9_MOUSE RecName: Full=M-phase phosphoprotein 9;
 1363::1591    9e-04  30% 2089 aa  MDC1_HUMAN RecName: Full=Mediator of DNA damage checkpoint protein
   56::157     9e-04  26%  492 aa  M5_STRP5 RecName: Full=M protein, serotype 5;Flags: Precursor;
  258::433     9e-04  25%  629 aa  K2C3_HUMAN RecName: Full=Keratin, type II cytoskeletal 3;AltName:
  135::393     9e-04  26%  484 aa  K1C14_MOUSE RecName: Full=Keratin, type I cytoskeletal 14;AltName:
  662::792     9e-04  27% 1931 aa  HMW2_MYCGA RecName: Full=Cytadherence high molecular weight protein
 2697::2982    9e-04  25% 3259 aa  GOGB1_HUMAN RecName: Full=Golgin subfamily B member 1;AltName:
  305::523     9e-04  27%  729 aa  GOGA5_MOUSE RecName: Full=Golgin subfamily A member 5;AltName:
  349::640     9e-04  27%  809 aa  EVI5_MOUSE RecName: Full=Ecotropic viral integration site 5
  756::848     9e-04  33% 2058 aa  DAPLE_XENLA RecName: Full=Daple-like protein;AltName:
  298::464     9e-04  30%  779 aa  CTGE5_MOUSE RecName: Full=Cutaneous T-cell lymphoma-associated
 1083::1189    9e-04  24% 1360 aa  CING_XENLA RecName: Full=Cingulin;
   24::268     9e-04  22%  820 aa  BICD2_MOUSE RecName: Full=Protein bicaudal D homolog 2;       
    1::1547

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxDNGVDLDDPFISSTPAGNHTQRELHRYSSFDAQLFTLNTSSPAQAKRALEAHLAET
APSA_EMENI      -------------------MDDPFVVS-PEGARDPPSTNQYSTFDAQLFNLDASTPAQAKRALEAHLAET
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      --------------------------------------------------------------------ET
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      ----------------------------------------------------------------------
KI15B_XENLA     --------------------------------------------------------------LESELATS
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     -----------------------------------------------------STIARLRGELEASMQEK
MLP2_YEAST      --------------------------------------------------------------------EK
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     -----------------------------------------------------------RQTLEDHLRRK
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     -------------------------------------------------------------------ADL
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      --------------------------------------------------------AQEMSASQRYSANQ
CP135_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
BRE1_DEBHA      --------------------------------------------------------------LAAHNKQL
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     ------------------DLNKNVASSTEAIQTTKTEINELKR-TIQGLQIELQSQLSMKDALEGQLADT
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      -----------------------------------------------------------RRTLEDHLKRK
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     --------------------------------HTENELHRLDKLTGKL-KIEESKSSDLGKKLTARQEEI
K1C14_RAT       ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      -----------------------------------KEKSRREVADAQRQAKEWASEAEKSSGGLSRLQDE
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
EBH_STAES       --------------ENAVNDTDPTHGMTQETINNYNAKKREAQNEIQKANMIINNGDATAQDISSEKSKV
EBH_STAEQ       --------------ENAVNDTDPTHGMTQETINNYNAKKREAQNEIQKANMIINNGDATAQDISSEKSKV
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      -----------------------------------------------------------KEMLKSQEEKL
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------TKSQEQLKSTLESDLSKK
GOGC3_ARATH     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     --------------------------------------------------------------LKSNLTVM
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      ----------------------------------------------------------------------
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      --------------------------------------------------------------LQLRATHK
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     --------------------------------------------------------------------ET
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     --------------------------------------------------------AEVKR-LSHELAET


                         .         .         *         .         .         .         .:140
query           ERRLEETSNLGTALIEQQRELMDKLKEVEQQHTDGEIGPDLRRKLNDLEREYNEIGRETARVALGPKVRL
APSA_EMENI      ERRLEEASKLGTALVEQRKDLEDKLRXXXXXXXXXXXXXXLRRKLADLEREYNEIGQETARAFLAPK-RL
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      KIRISELTNRIEMLLEENKRLKDE--------NDG-----MKNRIQDIEKEYNTIIRKL-----------
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      -KALEESILCETRKIEQ--EIKDQVVQKENK-TYFNNKFDNRYKLRDLEKNLAE---EEVRIT----EML
KI15B_XENLA     KQEYEEFKELTKKKVEQESELQSLMKS--NQHLENAIKENKRHEVSQLNRMHAETIKNMTRSRLVPRLSL
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     KSLLEEKERFQREVNKTEKEIVQERCNLEKELAKNKVDINLTHNLQTLEEENKHLADQMASLEL---QQV
MLP2_YEAST      ERMLEEAIDHLKAELEKQKSWVPSYIHVEKERASTELSQS-RIKIKSLEYEISKLKKETASF-IPTKESL
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     DSSLSDLEQQKRALVEEEEELLRLVKQMERDXXXXXXXXXXRRKITEIQFSC----RESAAVAQARPQRE
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     QKKEEDCAELKEKFIDAKKQIEQVQREVSVMRDEEKL---LRIKINELEKKKNQYSQDLQRTIQQLKEQL
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ---LKKEESLGKMEQELEARTRELSRTQEELMNSNQMSSDLSQKLEELQRHYSTLEEQRDHVKTGAESKI
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      AQELQEKAMQAEELLQQKIELRRQLHEALERADAGEAGLQLRLTENDFTKERNEIQAKTTEIDT-----L
CP135_HUMAN     ---------------------------------------DYNSEIHQITRERDELQRMLERFEIQSNVKL
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     --RLREAGNINQSLMTL-RTCMDVLRE-NQMYGTNKMVPYRDSKLTHLFKNYFDEGKVRMIVCVNPKA--
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
BRE1_DEBHA      NESVNNLQKINDTTVNKLNELENKQTNVKHL-LDKELREENETLKQQLQKSENDLVRRTARDELLSKQTI
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     EHRYSSIMNLQNIIHQKEAELSDIRADTERQANEYKILFDAKTKLENEIRTY--------------RILL
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      DLSLNDLEQQKNKLMEELRELLKLIKQMEQKQVAXXXXXXXXXXXXXARRKITEI-QYTCRENALPVCPI
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     SNLKEENMSQSQAITSVKSKLDETLSKSSKLEADIE---HLKNKVSEVEVERNALLASNER--LMDDLKN
K1C14_RAT       ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      TQRLRQTADLDTARLDKEL-LAQRLQGLEQEAEKKRRSQDLEEKVSRLEMELDE-ERNTVELLTDRINRS
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
EBH_STAES       EQVLQALQNAKNDLRADKRELQTAYKLIQNVNTNGKKPSSIQNYKSNIENQYNTAKNEAHNVLENTNPTV
EBH_STAEQ       EQVLQALQNAKNDLRADKRELQTAYKLIQNVNTNGKKPSSIQNYKSNIENQYNTAKNEAHNVLENTNPTV
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      KQRDEERRNLKSNIVTQIRHLNDLLKRVQAELENSQ---NDNRALRERQEQY-----ETNRIHL--EQRL
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      NIELEKKQEELVTLNQDKLEKEKKTNQLESDHSSATIKENYENQITQLTSEIIDLXXXXXXXXXXXXXNI
GOGC3_ARATH     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------ITRERDELQRMLERFEKYMEDIQSNVKL-L
CLIP1_CHICK     ETKLKEREEREQQLTEAKVKLENDIAEIMKSSGDSKMNDELRLKERQLEQIQLELTKANEKVQLQKNVEQ
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      ----------------------------------------------------------------------
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      EEVTELMSQIETSAKEHEAEI-NKLKE--NRVTQCEASENIPEKYQCESENLNEVASDASPESQNCSVAL
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     ETAEERVAELARDLVEMEQKLLMVTKETAQIQSFGRSMSSLQEELDELKRKYDASLKELAQL--------
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      ---LEIVFRVGLALLQMQAELMQLDMEGMLQHFQKVIGPEKSKKMKKLEKEYTTI--KTKEMEEQGEIKR
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     TREKIQAAEYGLAVLEEKHQLKLQFEELEVDY------EAIRSEMEQLKEAFGQAHTNHKKVAADGESR-


                         +         .         .         .         .         *         .:210
query           TGQEDGLATPSLDSRHHASPSVFSSQATNSPSKVTVPSRKQRNQPSSRVHDIEFATEISTSXXXXXXXXX
APSA_EMENI      AGGDDGLGTPSMDQKSPLHSALFAGQATXXXXXXXXXXXXXXXQ-SNRVHDIEFATEISTSLLAQVRQLQ
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      --EEKDNALKNLENTRQRLVNELEEQRTRFDTMTSEFDNLRTNYDSANKNTV--AIELTVK---------
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      TIQRQDIA---IERRKNTNCFSESSQV---------------DQYSVTETNLQYATNIGXXXXXXXXXXX
KI15B_XENLA     DGISNGLTTPK------------SGDVMDDIINEPIPPEMSEQAYEAIAEELRIVQEQVTALQVKLDEEE
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      -------------------PAHMQSRSMLRPLELSLPSQTSYSENEILKKELEAMRTFCESAKQDRLKLQ
CC150_HUMAN     TSDYHGLAQQKVE------------KITESKNKLAYENGKLQIKVKQLEEQVQSFTDTSLQNDHLRKMNK
MLP2_YEAST      TKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELEERLRSDLQSKIQEIE---SIRSCKDSQLKWAQ
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     QGRQK------------------EEELKQQVDELTLANRKAEKEMRELKYELSAVQLEKASSEEKARLLK
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     SNQKMEEAVQQYEK---VCKDLSVKEKLVEDMRLTLVEQEQTQAEQDRVLEAEEADWLATELDKWKEKFK
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     TALEQKIQQLSIDQKVTAETQEKEDVITHLQEKVASLEKRLEQNLSGEEHVQELLKEKTLAEQNLEDTRQ
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      ISDRRALETKLLNKEAEVDQLLYEKQLL----KTELNSYRGTNEDIDKLEKRQLVEELNDL---------
CP135_HUMAN     TAERDKLSVLYNEAQEELSALRKESTQTTAPHNIVSLMEKEKELALSDLRRIMAEKELREKLEHIEEVSL
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     ---EDYEENLQVMRFAEVTQEVEVARPVDKAICGLTPGRRYRNQPRGPVGNEPLVTDVVLQSFPPLPSCE
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
BRE1_DEBHA      TNDELNKLNKVLNERINALESERHETGDNSKSELSKDELIQRNMLNSEIKEIEQAFQETRENSLSKLMSV
SGM1_YEAST      TGKADSIAVDDVVHPDHNRTDCFDD------TMVSLPTWLPKNYTEFTVE--ELVKEISPEYLRLNKQID
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     EGDEGKFQT----SPHH--PSIVTKQTETVVTPVVITNVK------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      TQATSCRAVTGLQQEHDKQKAEELKQQVD---ELTAANRKAEQDMRELTYELNALQLEKTSSEEKARLLK
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     NGENIASLQTEIEKKR--------AENDDLQSKLSVVSSEYEN-----------LLLISSQTNKSLEDKT
K1C14_RAT       ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      -------------------PVHMQSRSMLRPLELALPNQASYSENEILKKELEAMRTFCDSAKQDRLKLQ
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      RDQVDQLRTELMQARQDLECDKISLERQNKDLKGRLASLEGFQKPSASLSQLESQNR-------------
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
EBH_STAES       NAVEDALAKEKLDQAINSQPSL-NGMTQESINNYTTKRREAQNIASS-------ADTIINNGDASIEQIT
EBH_STAEQ       NAVEDALAKEKLDQAINSQPSL-NGMTQESINNYTTKRREAQNIASS-------ADTIINNGDASIEQIT
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      -------------------PAHMQSRSMLRPLELSLPNQTSYSENDLLKKELEAMRTFCESAKQDRLKLQ
PUMA_PARUN      PTDEGEPRVKALMAAFATERQSLSDSLKKLASQLQISETKNRDDAERLKRDLLKAERVEEDLRRNLVEQT
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      KQQEINLKE-SNDLNQQLTNDKFELTKQLSDLKVEFDKSKQLSTRSSESNDIKELQESIISKDKERQLTS
GOGC3_ARATH     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     TAERDKLNVLYKEAKEELSTLRKESTNSTSPNHLVSCVEKEKERALSELRRITAEKELREKLKNIQERNA
CLIP1_CHICK     TAQKAEQSQQETLKTHQEELKKMQDQLTDM--------KKQMETSQNQYKDLQAKYEKETSEMITKH---
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      ----------------------------------------------------------------------
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      --QEDPSAEQTLESQH----SILKDEVTNLKLKLEMDAQHIKDEFFHEREDLEFKNELLLAKEEQGYVVE
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     -----------LGVQQHLSNTLKMAEQDNAEAQNVIAALKERNHHMERLLDVE-----------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      --QRESRTSSTIPSRYTITSNDISVKTVDEENTVTVASVSQSQLPGT-ANSVPECISLASLEDPVMLSKI
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     --KEQGLLNRERDALLSETAFSMNSTEENSLSHLEKLNQQLLSKDEQLLH---LSSQLEDSYNQVQSF--
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      LRTENRLLKQRIETEKHKCSSTYNEDFVLQLEKELVQARLSEAESQCALKEMQDKV-LDIEKKNNSFPDE
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ---EESLIQESASKEQYYVRKVLELQTELKQLRNVLTNTQSENERLTSV--AQELKEINQNVEIQRGRLR


                         .         .         .         +         .         .         .:280
query           XXXXEREEAIKALTLEKSHLELEAEGFTQRLRALDESEQRYKDENWSLETQTHDLLAAAKEASDRESRLT
APSA_EMENI      SLLAEREETLKTVNLEKSRLELEAEGYAQRIRALDESEERYKDENWALETKIHELMAAVKDVTDRETKLT
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      QIKEQRDEIIKKLAKELADLENKLNNETKMRGDAEKLNQRHLDEIDNFKKQINEYITEVRQNDDFDTQMK
MYO3_CAEBR      ----------KVKPMLKAGKEQEAMGLAEKIQKLEEAVQRGEIARSQLETQVADLVANLADAEERNEKLN
MYSC_CHICK      ----ELEEKQVSLVQEKNDLLLQLQAEQDTLADAEERCDLLIKSKIQLEAKVKELTERVEDEEEMNSELT
MCP5_SCHPO      XXXSEKEDLHKKLSVDNAHLIKQLDLLSSNMKTLMKEKTKVQGQRDLLEQRLQGLMKKLTEVESLTVSLN
KI15B_XENLA     SKNIKLEQQVNKLELERSNWNKEQQAFIAQIKSLEKQQQDNKNQEDVLKSEVHDLRVVLQSA-DREEKQE
CENPF_HUMAN     ------KEINASLNQEKMNLIQKSESFAEREKSISELSDQYKQEKLILETGNEDLSQKYKAAQEKNSKLE
UACA_HUMAN      NELAHKVAECKALALECERVKEDSDEQIKQLEALKDVQKRYESEGKVKQMQTHFLALKTSEAASGNHRLT
CC150_HUMAN     YLQTKYAQANSELSAKRVHLQ-QADAHLKEVKSILE---RSKEE---LSRTVKCRNAALKESQKLKEDLE
MLP2_YEAST      NTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQ--------YKFLDQNSDASTLEPTLR
JIP_CAEEL       -----------------------------------QSEEEEADETTSVDPENNDLLGADLTGMGRESELL
CC155_MOUSE     ----------------------------QVAKALDEELEDLKTLAKSLEEQNRSLMAQARHTEKEQQHLA
CC155_HUMAN     ----------------------------QFAKAMDEELEDLKTLARSLEEQNRSLLAQARQAEKEQQHLV
CING_DANRE      -------------TVSQSQLEIEEERVNASILAMEEELEGYKEEQWKKQSANQELLKAQQGKRELEEKLL
ANR26_MOUSE     ----------------KSRLEHEKVGWEQRLRALKQEEERRKGEQCQSEVEARQQLEASLRTLEMELKVK
UN84B_MOUSE     -------------TLRAEHHQDSEDLFKKIVQASQESEARVQQTEWKSVTQEAFQESSVKELGRLEAQLA
MYO3_CAEEL      ----------KVKPMLKAGKEQEAMGLAVKIQKLEEAVQRGEIARSQLESQVADLVANLADAEERNEKLN
CC155_BOVIN     ------EEGSARLGEEISALRKQLRSTQQALRGVDEELEDLKTLAKSLEEQNRSLLAQARHTEKEQQRLV
BPAEA_MOUSE     DKLDETNNTLKCLKEDLERKDQAQERYSQQLRDLGGQLNQTTDKAEEVRQEAND-LKKIKHTYQLE----
CROCC_MOUSE     ---------IAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLSLAAISLEMERQKRDAQSRQEQDR
MYH7_MOUSE      ----ELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKXXXXXXXXXXXMNAELT
MYH7_CANFA      ----ELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKXXXXXXXXXXXMNAELT
KI20B_MOUSE     DLETRSNQRLNTGTMDD--LDVLTRKFSKLQDELQESEEKYKADRKKWLEEKAVLTTQAKEAENVRNR--
MYSP_OPIFE      ---------------EASNLRNQVSKFNADLAAMKERELMSKTEEYELKRKLTLRITELEDTAERERARA
MYH7_PIG        ----ELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKXXXXXXXXXXXMNAELT
MYH7_HORSE      ----ELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKXXXXXXXXXXXMNAELT
MYH7_BOVIN      ----ELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKXXXXXXXXXXXMNAELT
TPR_HUMAN       -----------SLNAEREKVQVTAKTMAQH------EELMKKTETMNVVMETNKMLREEKE------RLE
MYO2_CAEEL      ---------------------------TKLRRDLEESGLKFGEQLTVLKKKGSD---AIQELSDQIEQLQ
MYH7_RAT        ----ELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKXXXXXXXXXXXMNAELT
MOEH_ANOGA      --------------------------------------QEYEDRLRSMQEEMERKQANLSEAQDTIRRLQ
GOGA1_HUMAN     QLLAARSSQAKAITLETRVRELE-----QTLQASEEQLQQSKGIVAAQETQIQELAAANQESSXRTQALE
EP15R_HUMAN     ----EKEEAIRQKTSEVQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQLRDMLSDVRQKCQDETQMI
MEDB_GIALA      -----REKTIKQLAREKAALETELKENSYNFDQLLEQKQQMRSDLNALREKAADYAEIERLLEDRRVMRT
CP135_HUMAN     FGKSELEKTIEHLTCVNHQLESEKYELKSKVLIMKETIESLENK---LKVQAQKFSHVAGDSSHQKTEV-
KI15A_XENLA     ---------------ERSNWNKEQQDLIAQIKSLEKQKQENKSQEDVLKSEVHDLRVVLQSA-DREEKQE
MYH6_MOUSE      ----ELEEKMVSLLQEKNDLQLQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKXXXXXXXXXXXMNAELT
LIPA2_MOUSE     ----QMKERLTALSSRVGEVEQEAETARKDLIKTEEMNTKYQ----------RDIREAMAQKEDMEERIT
KIF23_HUMAN     ILDINDEQTLPRLALEKRH--------NLRQMMIDEFN---------------------KQSNAFKALLQ
HMW2_MYCPN      ------EASLNRLVNEYNNFEFQKNYMVDRVAELNNKARFFKDELKRLQQEN------AAFVNSRYANWA
GOGA2_RAT       ---------------EVEQLQKELEGLTGQLRAQVQDNESLSHLNREQEGRMLELEREAQHWSEQAEERK
EP15R_MOUSE     ----EKEEAIKQKTSEVQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQLRDMLSDVRQKCQDETQTI
C117B_DANRE     -----RDQAIKTGNMEETETESDKKFYRAQIRDLEERPERYQLKCDELEVQEKDLSSKINNVEKEKKDIV
MYH7_MESAU      ----ELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKXXXXXXXXXXXMNAELT
MYH6_RAT        ----ELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKXXXXXXXXXXXMNAELT
MYH6_MESAU      ----ELEEKMVSLLQEKNDLQFQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKXXXXXXXXXXXMNAELT
MRCKB_RAT       -------------------LRQEHEDSTQRLKGLEKQYRLARQEKEELHKQSERLKSQTKELKDAHQQRK
GRDN_MOUSE      ----------KLETLEQENSELERENLTFQLESLEKENSQLDEENLELRRSVESL----KCASMRMAQLQ
CLIP2_HUMAN     ------EKALKAYQAEVDKLRAANEKYAQEVAGLKDKVQQATSENMGLMDNWKSKLDSL--ASDHQKSLE
ANR26_HUMAN     ---------------------------------------RRKEEQYRKEVEVKQQLELSLQTLEMELRVK
ODFP2_CHICK     ----EKEQARTASELSKSHKEAENNRLTTQIRNLERSEAQHKAEVECIKDQLKELLRAQKERAERSEECA
BRE1_DEBHA      T---DQENMVKKLTIEKTKLKTQINKSQELVSKLNDLEKSYLDKIEILTKSNNDFKIIRQSALQENSKLQ
SGM1_YEAST      DLTNELNRKSQIETTDSSFFKLEKDDLIDQLRKLAETELRQSNQIKALRTKVKDLEYEVSELNDSSAQSV
MYH8_HUMAN      ----ELEEKMVTLLKEKNDLQLQVQSEADSLADAEERCEQLIKNKIQLEAKIKXXXXXXXXXXXXXXXLT
MYH6_RABIT      ----ELEEKMVSLLQEKNDLQLQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKXXXXXXXXXXXXXXXXT
MYH11_CHICK     -------------TLEKDNADLANE-----IRSLSQAKQDVEHKKKKLEVQLQDLQSKYSDGERVRTELN
LMNA_XENLA      ----DARKTLDSVAKERARLQLE-------LSKIREEHKELKARNAKKES---DLLTAQARLKDLEALLN
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      ----ELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKXXXXXXXXXXXXXXXXT
CC150_MOUSE     ------ENLIQSLKMNIFHLQTEKESNPQKTAFLNDQLNIIQGEHSKLQLEVMNLRQQLKVVKEEEDRAQ
BPA1_HUMAN      DKLDETNNTLRCLKLELERKDQAEKGYSQQLRELEEAMQEASDEKGKLQREVDRITRAHAVAEKNIQHLN
ATG23_DEBHA     -----KTQEIKQVMTEKNELLTKIDNLTEENKNSGRELQQYKDDVEELTNKLNNYNNARSDLDDKINRLQ
ATG11_MAGGR     ------EAQLESLTKEKSDDALKAQGQVDFLR---NETRLQRESNEALQAQSQDELGXXXEAADVQLRAL
TG278_CAEEL     ---------------ENTQKELEAETHTETVRVLEENEQEYGKEKSALEAQNKTLLSEMEKVK----HVA
MYSS_CYPCA      -----------SLLQEKNDLQLQVTAESENLSDAEERCEGLIKSKIQLEAKLKETNERLEDEEEINAELT
MYS2_DICDI      ------------------------------------------------------------ELEDARRNLQ
CING_XENTR      --------ALQELQVEKETVELDKQMVTQRLQNLEESKKRVQDD------RSRQVKVLEDKLKRMEAELD
C144A_HUMAN     ----------------------------------DSEQLRIKEEECGKVVETKQQLKWNLRRLVKELRVR
SPO15_SCHPO     NQLKYIEKNVQKLLDEKDQRNVELEELTSKYGKLGEENAQIKDELLALRKKSHDLCANLKEKSDA-----
K1C14_RAT       --------------------------YLDKVRALEESDLEVKIRDWQRPTEIKDYSPYFKTIEDLKSKIL
HOOK_CULQU      -----------------------------------------KDELLQAETARDDLKMKSKEISDLQVKI-
GFAP_CARAU      --------------------------YIEKVRFLEQQNKMLVAELNQLRGKEPSRLGDIYQEELRERRQV
CYTSA_CHICK     -----------------------------------ELEQRYMDLAENARFEREQLLGV-------QQHLS
CNPD1_PEDPA     ------ENARKQAETERREKLLEAKDESHRYRAKVEKE--LKERRAELQKQEDRLLQREDSLDRKDNSFE
BPAEA_HUMAN     ------------------------------LKDLVDKYQHYEDASCGL-------LAGLQACEATASKHL
UACA_BOVIN      NELAHKVAECKALALECERVKEDSDEQIKQLEALKDVQKRYESEGKVKQMQTHFLALKEHLTSDAATELK
SYCP1_MOUSE     -----------------------------------EKENKMKDLTFLLE-ESRD---KANQLEEKTKLQD
IFEB_HELPO      ---------------EMQNLNERLAGYIEKVHFLDAQVKKLEAENEALRNRKSESLQPIRDAYENEDELS
ICR5_ARATH      ----------------KEAMNLSRQEITQLKSAVEAAETRYQEETLQIRSAYEQTEAVKSRYSQREAELT
EVI5L_HUMAN     -----REMQDKVLDMEKRNSSLPDENLQEELKALKVREGQAVASTRELKLQLQELSDTWQAHLARGGRWK
CTK2_XENLA      --------------------------------------EKKKRAAWDLKGQVNDMRDTVSNYKGKMQNLT
CING_SORAR      ----ELQERLQAEDREKTVLQSTNRKLERRVKELDDERQHVNDQKDQLSLKVKALKRQVDEAEEEIERLD
SSP5_STRGN      -------------TAKNEALKVENEAIKQR------NETAKATYEAAMKQYEADLAAIKKANEDNDADYQ
MUC16_HUMAN     ----------------------------------------------------------------------
EBH_STAES       ENKIRVEEATNALNEAKQHLTADTTSLKTEVRKLSRRGDTNNKKPSSVSAYNNTIHSLQSEITQTENRAN
EBH_STAEQ       ENKIRVEEATNALNEAKQHLTADTTSLKTEVRKLSRRGDTNNKKPSSVSAYNNTIHSLQSEITQTENRAN
CN145_HUMAN     -------------------------------RALQEEELHSKEEKLDIKSHQADLELEVKNSLDTIHRLE
C117A_DANRE     -----RDQAIKTGGMEETETESDKKFYQAQIRDLEERLERYQLKCDELEVQEKDLSSKINNVEKEKKDIV
UACA_CANFA      NELAHKVAECKALGLECERIKEDSDEQIKQLEALKDVQKRYESEGKVKQMQTHFL--ALKEHLTSEAELK
PUMA_PARUN      EIMRENQQLRSQLGVAQSDLA-NASGRKQQLEAVRAELRDHKQHLHDAISRIAELQRQLQDANAEKSRLT
MYSP_SCHJA      -----------------NELSLEVENLQKQKGKAEKDKSHLIMEVDNVLGQLDGALKAKQSAESKLEGLD
MYH2_HUMAN      ----ELEEKMVTLLKEKNDLQLQVQAEAEGLADAEERCDQLIKTKIQLEAKIKEVTXXXXXXXXXXXXXX
MYH2_CANFA      ----ELEEKMVTLLKEKNDLQLQVQAEAEGLADAEERCDQLIKTKIQLEAKIKEVTXXXXXXXXXXXXXX
MOEH_CULQU      --------------------------------------QEYEDRIRNMQEEMERSQANLIEAQDMIRRLE
KIF4_DICDI      EQLVKLTDQINLKTWEYNDLNSQCQQLTKTLQNVKSSNEQQEQSIVSLESQTS---AKIKSLELEISQIQ
GOGC3_ARATH     ---------LDAKLLEIKHLQMKLTG--QESHAIGPGMEHLKEVNKALEKENNELLEAALEESDATESLT
CYTSA_PANTR     -----------------------------------ELEQRYMDLAENARFEREQLLGV-------QQHLS
CYTSA_HUMAN     -----------------------------------ELEQRYMDLAENARFEREQLLGV-------QQHLS
CTRO_MOUSE      -----REAQVSAQHLEV-HLKQKEQHYEEKIKVLDNQIKKDLADKESLENMMQRHEEEAHEKGKILSEQK
CP135_MOUSE     VGKSDLEKTIEHLTYINHQLENEKYELQSKMLMMKETVESLENKS---KLQAQKLSHVTGDSSHQKTEMT
CLIP1_CHICK     --------------------DADIKGFKQNLLDAEEALKAAQKKNDELETQAEELKKQAEQADKRAEEVL
CE57R_XENTR     --------ALKTLQEKICRLELEKTHARDRLTNLTRVAGEHKKV---LESEKQSAELAAKEATNQQNDIG
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     -------------------------------------------------SQTPSTLNPTMPASERTVAWV
MYSN_ACACA      --------------LDKANLELE-ELRQEADDAARDNDKLVKD-NRKLKADLDEARIQLEEEQDAKSHAD
MDC1_PANTR      ----------------------------------------------------------------------
LIPA1_HUMAN     ----ELQEIISKQSREQSQMKERLASLSSHVTELEEDKDLIKSEEMNTKLQ-RDVREAMAQKEDMEERIT
KLP2_SCHPO      ----------ESLEVERSRTSELQEQFSVALREKAEAEANKIVSQKGMESLEIMLNSMKSENHQRMAMLE
GCC2_MOUSE      KLKYEREDLNRQLAVEQHNKEIQREHHQKEVSELSETFSGSEKEKLALMFEIQGLKEQCENLQHEKQEVV
CYTSA_MOUSE     -----------------------------------ELEQRYMDLAENARFEREQLLGV-------QQHLS
CYTSA_DANRE     ----RQERASMAAVLEECKAAVNDQAELSRCRVLLEQERQKVAELYSIKSDIHQLLEGVREAEAKASKLQ
CP110_HUMAN     ------EERVRTLQEEERWCESLEKTLSQTKRQLSEREQQ-------LVEKSGELLALQKEADSAEKQVA
CIP2A_MOUSE     ---------------------------------------QYRCQRTQAETEARTLAGMLREVERKNEELS
CEP72_MOUSE     --------------------------------------------------------------AEQQQQYT
AGLZ_MYXXD      ----------------KTHLEDRENELTAELQALGQA----KDE---LETDLNDRLQALSQAKDAEADLT
SMC4_YEAST      -----------------------------------ERELSERENNFRVASDTHEMEEELKKLRDHEPDLE
RGAG1_HUMAN     ----------------------------------------------------------------------
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      RQNLKEKHARHVADL-RAYYESEISSLKQKLEAKDISAEEWKKKNEILADRCGQLDSALNEATSR-----
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        ------KEALDKYELENHDLKTKNEGLKTENEGLKTENEGLKTENEGLKTEKKEHEAENDKLKQQRDTLS
K2C3_HUMAN      --------------------------------------------------------------------LR
K1C14_MOUSE     --------------------------YLDKVRALEEAELEVKIRDWQRPTEIKDYSPYFKTIEDLKSKIL
HMW2_MYCGA      ---------LEHLNLSKNYLDKQQEELNQKSDKMIEDLKVFERD---LKRQKEDLSIYEKSLQQKEASLI
GOGB1_HUMAN     ------SKAMASLQNERDHLWNELEKF----RKSEEGKQRSAAQPSTSPAEVQSLKKAMSSLQNDRDRLL
GOGA5_MOUSE     -----------------------------RLQEADQVLSSRTEALEALRSEKSRIMQDHKEGSSLQNQAL
EVI5_MOUSE      NNIARLQEELIAVKLREAEAIMGLKELRQQVRTLEEHWQRH------LARTSGRWKDPPKKNAVNE--LQ
DAPLE_XENLA     ---------------------------------LEVSYQGLNDENWRLQQM---LDTGNKKINDLEKELH
CTGE5_MOUSE     ------------------------------------------------------------------AKLN
CING_XENLA      --------ALQELQVEKETVELDKQMISQRLQSLEESKKRVQDD------RSRQVKVLEDKLKRMEAELD
BICD2_MOUSE     DDIKEYKFREARLLQDYSELEEENISLQKQVSVLRQNQKRLEEETEYLNSQLEDAI-RLKEISERQEEAL


                         .         *         .         .         .         .         +:350
query           SNLNALTVEKNNIQRELDELKQANGRLVEENMATQKALDSELHILRRNITLGESERNALQQKVDELAGQN
APSA_EMENI      SSLGAATAEKSAMERELEDLKQANAKLIEDHTAAQKANDAEINTLRRNLSAGDAERLTLQRKLEDMNTQN
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      TNQAKLSSMKNSLKKEIEKLSEMNNRLQQDKIGAKQKGDTELNLLTEKIRKVEIEFERIKKDNQELEDHE
MYO3_CAEBR      QLKATLESKLTDITGQLEDMQERHEDLTRQKKKTEQELDTKKHVQDLELTLRKAEQHQIRSLQDEMANQD
MYSC_CHICK      SKKRKLEDECSELKKDIDDLEITLAKVEKEKHATEKNLTEEMATLDENISKLTKEKKSLQQVLDDLQAEE
MCP5_SCHPO      DEKNKLTLELTNLRICLHELQAEKGETIDESEDSKNTLVTE-----------------------------
KI15B_XENLA     KELSQLSARHMAVQLQLDNFRLEHETLLEEKRSLQDAFDNLEEVMK-------FETDQLKQELSDSKHEN
CENPF_HUMAN     CLLNECTSLCENRKNELEQLKEANQNLMLELETVQQALRSEMTDLKQEIMTLKEEQNKMQKEVNDLLQEN
UACA_HUMAN      EELKDQLKDRNQIKQNVEEFKRDEGKLIEENKRLQKEL-----------SMCEMEREKKGRKVTEMEGQA
CC150_HUMAN     AVEDRENKKVGNFQRQLAEAKEDNCKMLENVLASQGALEKQIELGRRDSEIAKKERDLNQQRVQKLEAEV
MLP2_YEAST      KELEQIQVQLKDANSQI----QAYEEIISSNENALIELKNELAKTKENIELEKKEKWAREEDLSRLRGEL
JIP_CAEEL       DMKNALNIVKNDLINQVDELNSENMILRDENLSRQMVSEK----MQEQITKHEEEIKTLKQKLMEKENEQ
CC155_MOUSE     AEVETLPEENEKLLAERDGVKRRSEELATEKDALKRQLECERLICQREAVLSERTRHALARTLEEYRTTT
CC155_HUMAN     AEMETLQEENGKLLAERDGVKKRSQELMEKDTLKRQLFECEHLICQRDTILSERTRDSLAQTLEEYRVTT
CING_DANRE      AVVKQTDTDSNSVMKELDSLKKAQSELEKQKAETLKKQE-ELKSATRASEKRETELKAIDRLINQLKKEK
ANR26_MOUSE     SHLNQVLEERNETQRQLS--REQNARMLQDGLASHLCKQKEIEMTQKKMT---SEVSVSHEKEKDLLHKN
UN84B_MOUSE     SELAALTLKQNSVAYEV-------GLLPQKIQAARADVESQFPDWIRQFLLGDGARSGLLQR-DEMHAQL
MYO3_CAEEL      QLKATLESKLSDITGQLEDMQERNEDLARQKKKTDQELDTKKHVQDLELSLRKAEQEKIRSLQDEMANQD
CC155_BOVIN     AEMETLQEENGKLLAERDGVKRRSEELAEKDILKRQLYECEHLICQRDAILSERTRHALTKTLGEYRATT
BPAEA_MOUSE     --LESLHQEKGKLQREVDRVTRAHA-LAERNI---QCLNSQVHASRDEKDLSEERRRLCQRKSDHL---K
CROCC_MOUSE     NTLNALTSELRDLRAQLEEATAAHAQTVKENLGRQRACMREAEELRTQLRVLEDTRDGLRRELLEASQDS
MYH7_MOUSE      AKKRKLEDECSELKRDIDDLELTLAKVEKEKHATEKNLTEEMAGLDEIIVKLTKEKKALQQALDDLQAEE
MYH7_CANFA      AKKRKLEDECSELKRDIDDLELTLAKVEKEKHATEKNLTEEMAGLDEIIAKLTKEKKALQQALDDLQAEE
KI20B_MOUSE     -EMRKYADDRERCLKLQNEVETLTAQLAEKNSELQKWREERDQL----VTAVETQMKALLSSCKHKDEEI
MYSP_OPIFE      SNLEKLTIEIKDLQNEVDSLSAENAELARR----AKAAENLANDLQRRVDELTIEINNLHSQNSQLEAEN
MYH7_PIG        AKKRKLEDECSELKRDIDDLELTLAKVEKEKHATEKNLTEEMAGLDEIIAKLTKEKKALQQALDDLQAEE
MYH7_HORSE      AKKRKLEDECSELKRDIDDLELTLAKVEKEKHATEKNLTEEMAGLDEIIAKLTKEKKALQQALDDLQAEE
MYH7_BOVIN      AKKRKLEDECSELKRDIDDLELTLAKVEKEKHATEKNLTEEMAGLDEIIAKLTKEKKALQQALDDLQAEE
TPR_HUMAN       QDLQQMQAKVRKLELDILPLQEANAELSEKSGMLQ------------------AEKKLLEEDVKRWKARN
MYO2_CAEEL      KQKGRIEKEKGHMQREFDESSAAEAKLRADQERIAKGYEVRLLELRRQLQDFVSSKGRLNSENSDLARQV
MYH7_RAT        AKKRKLEDECSELKRDIDDLELTLAKVEKEKHATEKNLTEEMAGLDEIIVKLTKEKKALQQALDDLQAEE
MOEH_ANOGA      EQLNQVQAAKEELEQRQNELHEMMQRLEEKNMATERALEEEIRVIQEEVTLKDSETKRLHEEVEE-----
GOGA1_HUMAN     AQIVALAADQTTAEQGMRQLEQENAALKECRNEYERSLQNELKKLKEEWSQREIVSVAMAQALEEVRKQR
EP15R_HUMAN     SSLKTIQSQESDLKSQEDDLNRAKNRLQQEETQLEQSIQAQLETIIKSLKSTQDEINQARSKLSQLHESR
MEDB_GIALA      TDVDSLIQEKRLRDRELAHLRDRMSRVVEERIQKEKENNTELEQQQRTATVRETEMSALREKANELDGYN
CP135_HUMAN     ---NSLRIVNEQLQRSVDDYQQAQIKILEEKILKMTSQDEEAHVMKKTIGVIDKEKDFLQETVDEKTEKI
KI15A_XENLA     KELSQLSARHMDVQLQLDNVRLEHETLLEEKRSLQDAFDNLEEVMKFEI-------DQLKQEISDSKHEN
MYH6_MOUSE      AKKRKLEDECSELKKDIDDLELTLAKVEKEKHATEKNLTEEMAGLDEIIAKLTKEKKALQQALDDLQAEE
LIPA2_MOUSE     ------TLEKRYLQRESTSIHDMNDKL-ENELANKEAIEEKNRQLQERLELAEQKLQQTMRKAETLPEVE
KIF23_HUMAN     EFDNAVLSKENHMQGKLNEKKMISGQKIERLEKKNKTLEYKIEILEKTTTIYEEDKRNLQQ---ELETQN
HMW2_MYCPN      DFQSNYQLKLDQFQALIDQQNQTIKQLNEQIAANQGLIDQNVQRLQQNHSLDQQERDALLYEVDHLYNEL
GOGA2_RAT       QILESMQSDRTTISRQLAELQNGFVRLTNENMEITSALQSEQHV-----------KKELARKLGELQERL
EP15R_MOUSE     SSLKTIQSQESDLKSQEDDLNRAKNRLQQEETQLEQSIQAQLETILRSLKCTQDDINQARSKLSQLQESH
C117B_DANRE     LFLKRTLAKKED---KLNDLAETLSRHQQAQEAERESFESQLSLLRRE----------LQENKEKYTSEN
MYH7_MESAU      AKKRKLEDECSELKRDIDDLELTLAKVEKDKHATEKNLTEEMAGLDEIIAKLTKEKKALQQALDDLQAEE
MYH6_RAT        AKKRKLEDECSELKKDIDDLELTLAKVEKEKHATEKNLTEEMAGLDEIIAKLTKEKKALQQALDDLQAEE
MYH6_MESAU      SKKRKLEDECSELKKDIDDLELTLAKVEKEKHATEKNLTEEMAGLDEIIAKLTKEKKALQQALDDLQAEE
MRCKB_RAT       RALQEFS-ELNERMAELRSQKQKVSRQLRDKEEEMEVAMQKIDSMRQDIRKSEKSRKELEARLEDAVAEA
GRDN_MOUSE      LENKELESEKEQLRKGL-ELMRASFKKTERLEVSYQGLDTENQRLQKALENSNKKIQQLESELQDLEMEN
CLIP2_HUMAN     DLKATLNSGPGAQQKEIGELKKMEHQLELGNLQAKHDLETAMHVKEK-----EALREKLQEAQEELAGLQ
ANR26_HUMAN     SNLNQVVQERNDAQRQLS--REQNARMLQDGILTNHSKQKEIEMAQKKMXXXXXXXXXXXK---DLSHKN
ODFP2_CHICK     GQLAVQLAEKDSYVAELSTLESWRSRY---NKVVKDKSDLELEMVTVNSRIAD-----LLEQQATLEDKM
BRE1_DEBHA      ESLRAIDVRKASLEKELSGMKDKYSDKVQENTSFTQELN------EKNLMMGKLE---------------
SGM1_YEAST      ENYNELQSLYHNIQGQLAELKDADKQTLEKNI---KEKDDLITILQQSLTLLEKEKSEFQTEKKALQEAT
MYH8_HUMAN      AKKRKLEDECSELKKDIDDLELTLAKVEKEKHATEKNLTEEMAGLDETIAKLSKEKKALQQTLDDLQAEE
MYH6_RABIT      AKKRKLEDECSELKKDIDDLELTLAKVEKEKHATEKNLTEEMAGLDEIIAKLTKEKKALQQALDDLQAEE
MYH11_CHICK     EKVHKLQIEVENVTSLLNEAESKNIKLTKD-VATLGSXXXXXXXXKLNVTTKEDDKNSLQEQLDEEVEAK
LMNA_XENLA      SKDAALTTEKRNLENEIRELKAHIAKLEASLADTKKQLQDEM--LRRVDT-----ENRNQTLKEELEFQK
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      AKKRKLEDECSELKRDIDDLELTLAKVEKEKHATEKNLTEEMAGLDEIIAKLTKEKKALQQALDDLQAEE
CC150_MOUSE     DEMQRLTATL-----EIATETKKNAAVIEEELKTTKRMNLKIQELRRQLAQEKLVRESLETSASSMLLKV
BPA1_HUMAN      SQIHSFRDEKELCQRKSDHLKEQFEKSHEQNIKAEKENNDKIQRLNEELEKSNECAEMLKQKVEELTRQN
ATG23_DEBHA     EGLNKSNEANESLQNKLEEIERLNQHVSESE--TQMDLLKSINTEKDEIISGDTKKGELVQKVNKQKQVI
ATG11_MAGGR     RELYTTFVKSAGIPEDVNDLADTVLNNAAETLAKVQNLDADISIMRSNLALAQKDLRAQQANALEKLAKE
TG278_CAEEL     ENLEAFTSDKDNLLEELESLKQEIAQLNEKISTKETEKDSELEKTIAQLEIDNSSKSDQIEKLDELVKKN
MYSS_CYPCA      AKKRKLEDECSELKKDIDDLELTLAKVEKEKHATEKNLTEEMASQDESIAKLTKEKKALQQTLDDLQAEE
MYS2_DICDI      KEIDAKEIAKSNLQREIVEAK---GRLEEESIASRKRLEAEIDALTAQV---DAEQKAKNQQIKENKKIE
CING_XENTR      EEKNTVELLSDRINRSREQMEQQRAELMQERARGQDLECDKISLERQNKDLGRLANMEGQQKPSVNVSHL
C144A_HUMAN     NNLDLVVQERNDAQKQLSE--EQDARILQDQILTSK--QKELEMARKKM---NSEISHRHQKEKDLFHED
SPO15_SCHPO     --LEQLTNEKNELIVSLEQSNSNNEALVEEDLANRXXXXNVISVIRSDLVRVNDELDTLKKDKDSLSTQY
K1C14_RAT       ----AATVDNANVLLQID-----NARLAADDFRTKFETEQSLRI---NV---ESDINGLRRVLDELTMQI
HOOK_CULQU      DELHSATAEIAQLKDEIDILKEANDKLCETQLQTYKKKLEDYNDLKKQIKMLE-ERSALKQNSDF-----
GFAP_CARAU      DGLNALEIERDNLASDLATLKQ---RLQEENALRQEA-ENNLNTFRQDVDEAALNRVQLERKIDALQDEI
CYTSA_CHICK     NTLKMAEQDNKEAQEMIGALKERNHRIIESEQKSKTAIASTLEEYKATVASDQIEMNRLKQKVAELYSLD
CNPD1_PEDPA     KRENSLERKEQKLQKHIDEQQQKASSLVEERQQELERVSNLTQEDAKNLIISETEAKLEKERADAEAEAD
BPAEA_HUMAN     SE--PIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPA-KNDIQKTLDDIVGRY
UACA_BOVIN      DQLKDMKVKRNQIKQNVEEFKRDEGKLMEENKRLQKEL-----------SMCELEREKRGRKLTEMEGQL
SYCP1_MOUSE     ENLKELSEKKDHLTSELEDIKMS----MQRSMSTQKALEEDLQIATKTISQLTEVKEAQMEELNK-----
IFEB_HELPO      STKGVSEAKVAGLQDEIASLRELIGTYENQSKDYRKKIESELHTLRIRCGSLEDENAKVRELLDKIQDQN
ICR5_ARATH      EELNRTKDEIEGLRKELEKVKE------DESTGDLKKLESDLMEVRGSLMDKEMERSAMEKKVE------
EVI5L_HUMAN     ESPRKLVV--GELQDELMSVRLREAQALAEGRELRQRLETQDHIHRNLLNRVEAERAALQEKLQYLAAQN
CTK2_XENLA      GENARLLNSKEKLQREVEVLASENSKLSQERC----TLESQLREVRQQVSTFEREVARLQEKIEELQGAN
CING_SORAR      GL-------RKKAQRELEEQHEANEQLQARIRALEK----------------------------------
SSP5_STRGN      AKLAAYQTELARVQKANAEAKEAYDKAVKENTAKNTAIQAENEIKQRNETAKATYDAAVKKYEADLAAVK
MUC16_HUMAN     ----------------------------------------------------------------------
EBH_STAES       TIINKPIRSVEEVNNALHEVNQLNQRLTDTINLLQPLANKE--------SLKEA-RNRLESKINE-----
EBH_STAEQ       TIINKPIRSVEEVNNALHEVNQLNQRLTDTINLLQPLANKE--------SLKEA-RNRLESKINE-----
CN145_HUMAN     SELSQMKVEKAHLEEEIAELKKSQAQDKAKLLEMQESI-KDLSAIRADLALAEEERKAVLKDLSDLTAQA
C117A_DANRE     LFLKRTLAKKED---KLNDLAETLSRHQQAQEAERESFESQLSLLRRE----------LQENKEKYTSEN
UACA_CANFA      DQLKDMKAKYEGASAEVGKLRKQNELLVEQFRRDEGKLVEENKRLQKELSMCETERDKKGRRVAEVEGQV
PUMA_PARUN      DRIIGLEKTIGTLRNTETELRAQLSTAADE----RKALNSELEEMRRRIVQMESEKKDVDNQLEEV----
MYSP_SCHJA      SQLNRLKTLTDDLQRQLTELNNAKSRLTSENFELLHIQDYEAQILNYS-----KAKSSLESQVDDL----
MYH2_HUMAN      XKKRKLEDECSELKKDIDDLELTLAKVEKEKHATEKNLTEEMAGLDETIAKLTKEKKALQQTLDDLQAEE
MYH2_CANFA      XKKRKLEDECSELKKDIDDLELTLAKVEKEKHATEKNLTEEMAGLDETIAKLTKEKKALQQTLDDLQAEE
MOEH_CULQU      EQLKQLQAAKDDLEQRQNELQVMITRLEEKNMAAERAKQEEVHKIQEEVSVKDSETKRLQEEVEEARRKQ
KIF4_DICDI      ENHRLEVLELNRCKNQLSEMEQDNIQLNERQLLHQKTKENEILSMESNIIDLENQTKELKSKI-ETAQQD
GOGC3_ARATH     RHPSTLDKEKPESFPGKEEMEQSLQRLEMDLKETQRERDQELKRLKQHLLXXXXXXXXXXXXXXRLIEEL
CYTSA_PANTR     NTLKMAEQDNKEAQEMIGALKERSHRIIESEQKGKAALAATLEEYKATVASDQIEMNRLKQKVAELSGDK
CYTSA_HUMAN     NTLKMAEQDNKEAQEMIGALKERSHRIIESEQKGKAALAATLEEYKATVASDQIEMNRLKQKVAELSGDK
CTRO_MOUSE      AMINAMDSKIRSLEQRIVELSEANKLAANSSLFTQRNMKAQ----EEMISELRQQKFYLETQAGKLEAQN
CP135_MOUSE     S----LRIVSEQLQRSLDDCQQEQIKMLEENLSHRMTVQSETHAMKKTIGVMDKEKDFLQETVDEKTEKI
CLIP1_CHICK     QTMEKVTKEKDAIHQELENSRQTNEKLQNE----------------------------------------
CE57R_XENTR     KQLNNAKQRCSLLEKQLDYMKE-----MMENADTQKTTIHEHQMLT------QKEQKEIQSKLKKL----
TRIPB_HUMAN     ------------------------------------SLDSELHDLRLNLEAKESEKETLIAEIEELDRQN
SYGP1_HUMAN     SNMPHLSIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKENRKLEEYERRLLSQQTSKILMQY
MYSN_ACACA      SSSRRLLAE-------IEELKK---RVAKETSDKQKAQDQKANYQRENESL-KADRDSIERRNRDAERQV
MDC1_PANTR      ----------------------------------------------------------------------
LIPA1_HUMAN     ------TLEKRYLQREATSVHDLNDKLENEKDSMHRQTEDKNRQLQERLELAEQKLQQTLRKAETLPEVE
KLP2_SCHPO      EN-HARVMETAELQHELQDFQKANSLIMEYKNELQSAEEHFSHKIKELTSENELKISRLQEEKDSLLKKV
GCC2_MOUSE      LNYESLREMMEILQTELGE---SAGKISQEFETMKQQQASDVHELQQKLRSAFNEKDALLETVNRLQGEN
CYTSA_MOUSE     NTLKMAEQDNKEAQEMIGALKERSHRIIESEQKGKAALAATLEEYKATVASDQIEMNRLKQKVAELSGDK
CYTSA_DANRE     DDL-------GHARSEVACLQDTLNKLDAEYRDFQSVVQKELAEQKRAI---EKQREDLQEKETEI-GDM
CP110_HUMAN     SLKEALKIQRSQLEKNLLEQKQENS-CIQKEMATIELVAQDNHERARRLM---KELNQMQYEYTEL---K
CIP2A_MOUSE     VLLKSQQLESERAQNDIEHLFQHSKKLESVAAEHEILTKSYMELVQRNEAT-EKKNTDLQTTCESLNKHI
CEP72_MOUSE     ATVTKMTAELNNTKRELDTLRQHLDKSLEEN----SHLKSLLYNVKKEVKTADTS-TALTLQITGLQASM
AGLZ_MYXXD      GQIQALTSQLEETQRQLDD----SQRTGEQLSARVAQLEDTVSQRESTIESLQGDVAARDQRISELSG--
SMC4_YEAST      SQISKAEMEADSLASELTLAEQ---QVKEAEMAYVKAVSAQLNVVMKNLERLRGEYNDLQSKKEKIKGLQ
RGAG1_HUMAN     ----------------------------------------------------------------------
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      ----VRTLEKNN-----------------------NLLEIEVSDLRERFNAASSASKVLQERIEEMRTSN
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        TQKETLEREVQNTQYNNETLKIKNGDLTKELNKTRQEL--------------------------------
K2C3_HUMAN      SYLDNILGERGRLDSELEDLVEDFKKKYEDEINKRTAAENEFVTLKKDVDSAYMNKVELQAKVDALIDEI
K1C14_MOUSE     ----AATVDNANVLLQID-----NARLAADDFRTKFETEQSL---RMSV---EADINGLRRVLDELTMQI
HMW2_MYCGA      NFQNDVTVQKNEAYHKAQAIHQ-------ELELKKAAIENELRKLRKAVDADKEENTKLKKFIDELANER
GOGB1_HUMAN     KELKNLQQQYLQINQEITELHPLKAQLQEYQDKTKASWQHELHQLRMEKSSWEHERRMKEQYLMAISDKD
GOGA5_MOUSE     QTLQERLHEADTLKREQESYKQ----MQSEFAARLNKMEVDRQNLAEAVTLAERKYSEEKKKVDELQQQ-
EVI5_MOUSE      DELMSIRLREAETQAEIREMKQ---RMME--METQNQINSNQ--LRR----AEQEVNSLQEKVCSLSVKN
DAPLE_XENLA     DTEK----ENKDLQRTLEEMKICNKRL-ERMEEENKAKEQEMVQLEKDNKILQKESKRLWQQVE------
CTGE5_MOUSE     ASLKALEGERNQVYTQLSEVDQVKEDLTEHI----KSLESKQASLQSEKTEFESESQKLQQKLKVITELY
CING_XENLA      EEKNTVELLTDRVNRSRDQMEQQRAELNQERSRGQDLECDKISLERQN----------------------
BICD2_MOUSE     ETLKTEREQKNNLRKELSHYMSIN----------------------------------------------


                         .         .         .         .         *         .         .:420
query           QELAKAVAAKLRQHEADSAKDPNPEDNRKASDDLXXXXXXXXXXXXXXXRHGLLESETLKSSLHHAHRMI
APSA_EMENI      QELAKAVAMRLRQQEAESTREVVRPHDSEDEEQATPENSPPPSPNKFTPRHNHLETETLRSSLGHAHRMI
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      RTARDDLKQETRNHLLAKELEEARADIVALNDRLAKMDANFKIKLDETIKKSPADHETIKSRESKSEKII
MYO3_CAEBR      ESVAKLNKEKKHQEES----------NRKLNEDLQSEED---------------KVNHLEKIRNKLEQQM
MYSC_CHICK      DKVNTLSKAKVKLEQQVDDLEGSLEQEKKVRMDL------------------------------------
MCP5_SCHPO      ----------------------------------------------------------------------
KI15B_XENLA     E---------------------------------------------------------------------
CENPF_HUMAN     EQLMKVMKTKHECQNLESEPIRNSVKERES----------------------------------------
UACA_HUMAN      KELSAKLALSIPAEKFENMKSSSNEVNEKA----------------------------------------
CC150_HUMAN     DQWQARMLVMEDQHNSEKALGVAREDNRKLAMSL---------------EQALQTNNHLQTKLDHIQEQL
MLP2_YEAST      GEI-RALQPKLKE---------------------------------------------------------
JIP_CAEEL       EE--------------------------------------------------------------------
CC155_MOUSE     QELRQEIS--------------------------------------------------------------
CC155_HUMAN     QELRLEI-SRLEEQLSQTYEGPD-----------------------------------------------
CING_DANRE      EELSKAIEKTQQPLVSDQTKDP------------------------------------------------
ANR26_MOUSE     QRLQDEVA--VLRLEMDTIKSHNQEKEKRYLEDI------------------------------------
UN84B_MOUSE     QELENKILTKMAEMQGKSARE-------------------------------------------------
MYO3_CAEEL      EAVAKLNKEKKHQEES----------NRKLNEDL------------------------------------
CC155_BOVIN     QEL-------------------------------------------------------------------
BPAEA_MOUSE     EEFERSHAQLLQNIQAE-----------------------------------------------------
CROCC_MOUSE     SEAHRQEASELRRSLSEGAKE--REALRRSNEEL------------------------------------
MYH7_MOUSE      DKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDL------------------------------------
MYH7_CANFA      DKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDL------------------------------------
KI20B_MOUSE     QELRKA-AAKSTGTE-NQTMNPKPEYN-------------------------------------------
MYSP_OPIFE      MRLKSQVNDLV---DKNAALD---RENRQLSDQV----------------------KDLKSTLRDANRRL
MYH7_PIG        DKVNTLTKAKVKLEQHVDDLEGSLEQEKKVRMDL------------------------------------
MYH7_HORSE      DKVNTLTKAKVKLEQHVDDLEGSLEQEKKVRMDL------------------------------------
MYH7_BOVIN      DKVNTLTKAKVKLEQHVDDLEGSLEQEKKVRMDL------------------------------------
TPR_HUMAN       Q------------HLVSQQKDPDTEEYRKL---LSEKEVHTKRIQQLTEEIGRLKAEIARSSLTNNQNLI
MYO2_CAEEL      EELEAKIQAANRSNELDHAKRQAEEESR--------------------------ERQNLSNLSKNLAREL
MYH7_RAT        DKVNTLTKAKVKLEQQVDDLEGSLDQDKKVRMDL------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     EEFQQQAA--------------------------------------------------------------
EP15R_HUMAN     QEAHRSL---------------------------------------------------------------
MEDB_GIALA      RE------RQAREHEINMLRDKALESDKLRQDN-------------------------------------
CP135_HUMAN     ANLQENLANK------------------------------------------------------------
KI15A_XENLA     ETL-------------------------------------------------------------------
MYH6_MOUSE      DKVNTLTKSKVKLEQQVDDLEGSLEQEKKVRMDL------------------------------------
LIPA2_MOUSE     AELAQRIAALTKAEEARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEEKNVLIQESENFR
KIF23_HUMAN     QKLQRQFSDKRR----------------------------------------------------------
HMW2_MYCPN      YEL-------------------------------------------------------------------
GOGA2_RAT       GELKETV--ELKSQEAQGLQE-------------------------------------------------
EP15R_MOUSE     LEAHRSL---------------------------------------------------------------
C117B_DANRE     MTLAGKLAS---LEEFSTQRETLIAERRSLEEQLRKQKEDHQAEIYNLEKKAVLDNDRLKKEMLQHVAAV
MYH7_MESAU      DKVNTLTKSKVKLEQQVDDLEGSLEQEKKVRMDL------------------------------------
MYH6_RAT        DKVNTLTKSKVKLEQQVDDLEGSLEQEKKVRMDL------------------------------------
MYH6_MESAU      DKVNTLTKSKVKLEQQVDDLEGSLEQEKKVRMDL------------------------------------
MRCKB_RAT       SK-----ERKLREHSESFSKQMEREGGRGPGATLEHQQEISKIRSELEKKVLFYEEELVRREASHVLE-V
GRDN_MOUSE      QTLQKSL---------------------------------------------------------------
CLIP2_HUMAN     RHWRAQLEVQASQHELQEAQD-------------------------------------------------
ANR26_HUMAN     SMLQEEIA--MLRLEIDTIKNQNQEKEKKCFEDL------------------------------------
ODFP2_CHICK     REDRDALMDKLHQQTTETTSFRMENERLKAS----------VVPMEEKLNQAHVEVQQLKSSVRNYEDLI
BRE1_DEBHA      ----------------------------------------------------------------------
SGM1_YEAST      VDQVTTLETKLEQLRIESTQNLDAKSNRDFVDD-------------------------------------
MYH8_HUMAN      DKVNILTKAKTKLEQQVDDLEGSLEQEKKLRMDL------------------------------------
MYH6_RABIT      DKVNTLTKAKLKLEQQVDDLEGSLEQEKKVRMDL------------------------------------
MYH11_CHICK     QNLERHIS--------------------------------------------------------------
LMNA_XENLA      SIYNEEMRETKRRHE-------------------------------------------------------
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      DKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDL------------------------------------
CC150_MOUSE     QEMGSVVEAERQQVHALQEKCTALHSSMKTTQDL------------------------------------
BPA1_HUMAN      NE--------------------------------------------------------------------
ATG23_DEBHA     ADYEKDYSKALEDIKSLQSKGENTSLNDEIED--------------------------------------
ATG11_MAGGR     ETTSMHLREQCDEHKAKNALEGELADGRKQLDEL------------------------------------
TG278_CAEEL     EEI-KTISAKTAQ---------------------------------------------------------
MYSS_CYPCA      DKVNTLTKAKTKLEQQVDDLEGSLEQEKKLRMDL------------------------------------
MYS2_DICDI      TEL-KEYRKKFGESEKTKTKEKLETDYKRAKKEAADEQQQRLTVENDLRKH-LSEISLLKDAIDKLQRDH
CING_XENTR      EAKLQDIQERLQSEEREKA---------------------------------------------------
C144A_HUMAN     CMLQEEIA--LLRLEIDTIKNQNKQKEKKYFEDI------------------------------------
SPO15_SCHPO     SEVCQ-----------------------------------------------------------------
K1C14_RAT       ESLKEELAYLKKNHEEEMASDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEDFFTKTEELNREV
HOOK_CULQU      EEEAKKYAGLKGQVEL----------YKKEIQDL----------------HAKLDSEMGKTKTEFEHNQL
GFAP_CARAU      SFLRKVHEEEMRQ---------------------------------------------------------
CYTSA_CHICK     KEKAETLASSLQEELAHTRNDANRLQDAKVEDEYRVF------------------QEEAKKQIEDLNVTL
CNPD1_PEDPA     QTARKLIAEAIQRSAADMASE-------------------------------------------------
BPAEA_HUMAN     EDLSKSV---------------------------------------------------------------
UACA_BOVIN      KDLSAKLALSIPAEKFENMKSLSNELNEKAK---------KLIDVEREYERSLNETRPLK-------REL
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      RRLRADLDTETSAHEADCLAQTKTEE--------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     KGLQTQLSSRRKQAEAE-----------------------------------------------------
CTK2_XENLA      AILTKQLLDKEVKLDCVSGENTSLKHTNEQTDEIAALKVCLAEKD--------TEVHSLDTERRRLHNLV
CING_SORAR      ----------------------------------------------------------------------
SSP5_STRGN      QANATNEAAKLAAYQTELARVQKANADAKAT---------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CN145_HUMAN     KSRDEETATIITQLKLE--RDVHQRELKDLTSSLQSVKTKHEQNIQELMKH-------FKKEKSEAENHI
C117A_DANRE     MTLAGKLAS---LEEFSTQRETLIAERRSLEEQLRKQKEDHQAEIYNLEKKAVLDNDRLKKELQH----V
UACA_CANFA      KELLAKLTLSVPTEKFESMK--------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      DKVNTLTKAKIKLEQQVDDLEGSLEQEKKLRMDL------------------------------------
MYH2_CANFA      DKVNTLTKAKIKLEQQVDDLEGSLEQEKKLRMDL------------------------------------
MOEH_CULQU      TE--------------------------------------------------------------------
KIF4_DICDI      FEIEKNYHTGLNETNTTTIKTMNEELTR------------------------------------------
GOGC3_ARATH     RQTNEYQRSQI-SHLEKSLKQSNQEDNRLSNDNQIRKLKDTVDDLNQKLTNCLRTIESKNVELLN----L
CYTSA_PANTR     SDIQDLLSVRLDKEKAETLASSLQEDLAHTRNDANRLQDAIAKVEDEYRAF----QEEAKKQIEDLNMTL
CYTSA_HUMAN     SDIQDLLSVRLDKEKAETLASSLQEDLAHTRNDANRLQDAIAKVEDEYRAF----QEEAKKQIEDLNMTL
CTRO_MOUSE      RKLEEQLEKISHQDHSDKS---------------------------------------------------
CP135_MOUSE     ANLQESLLSK------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CE57R_XENTR     EVLEKMCTRLSATHKSAETKIQHEEQNRKALQD-------------------------------------
TRIPB_HUMAN     QEATKHMQLSKQQNEGDSKQDLNDEKKRQLEDD-----KMDITKELDVQKEKLIQSEVALNDLHLTKQKV
SYGP1_HUMAN     QARLEQSEKRLRQQQAE-----------------------------------------------------
MYSN_ACACA      RDLRAQLDDALSRLDSEKAKEKSVEANRELK-----------KVVLDRERQSLESLSKFNSALESDKQIL
MDC1_PANTR      ----------------------------------------------------------------------
LIPA1_HUMAN     AELAQRVAARLRQMEAQQREKMNEEHNKRLSDTVDKLLSESNERLQLHLKERMAALEDKNSLL----REV
KLP2_SCHPO      QEGASLAMQRLEKKRLQSAIQPLQEENNSLKQQIEQLQRELASE--------TVVKENLKSSLDQQSANV
GCC2_MOUSE      QELVPELESTIKNLQADNS---------------------------------------------------
CYTSA_MOUSE     SDIQDLLSVRLDKEKAETLASSLQEDLAHTRNDANRLQDTIAKVEDEYRAF----QEEAKKQIEDLNMTL
CYTSA_DANRE     KETIFELEDEVEQHRAVKLHDSDLENSMKKLQDQKHDMEREIKILHRRLREESAEWRQFQADLQTA----
CP110_HUMAN     KQMANQKDLERRQMEISDA---------------------------------------------------
CIP2A_MOUSE     ETMKKLNEALKQQNEKTIAQLIEKEEQRKE------------------VQSQLADRECKLSNLHKIAKSQ
CEP72_MOUSE     KQLSGEV-VELKQH--------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      DEIMKIGGIKLQMQNS------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      KEKDNTITLKCRLQDLEEAF----ENAYKLSDDKKMFQDLLGEYESLGKEHGRVKDNTTENKLLDAHTQI
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      DFLRTLYDAELSQHISDTSVVLSMDNNR--SLDLDSIIAEVRAQYEDIAQRSKAEAEALQTKLGELQTTA
K1C14_MOUSE     ESLKEELAYLKKNHEEEMASDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEFFSKTEELNREV
HMW2_MYCGA      KEL-------------------------------------------------------------------
GOGB1_HUMAN     QQLS------------------------------------------------------------------
GOGA5_MOUSE     --------VKLHRASLESAKQELVDYKQKATRILQSKEKLINSLKEGSSFEG-LESSTASSELRHEKEMI
EVI5_MOUSE      KGLAQLSEAKRRQAEIE-----------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     QENEMKLHRKLTVEE--NYRLEKEEKLSKVDEKI---------------SHATEELETCR---QRAKDLE
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           QTLKGTIHREKTEKIELKRMLQDARDELEQRRAEPVRPISSHNRRQKPKGDNFKKPARPEMLGAGRKGIT
APSA_EMENI      QNLRSTIHREKTEKIELKRMLQEARDEVEQRRRDSVAANGPTNKRQKTKAET-RKPARPDLLGAGRKK-A
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      VKHETKIYEINKYRAELEKLESD-KDDLEKRIIGLQDELNEKDRRLNAEIDDLKRKLQTEIEKVRKETTT
MYO3_CAEBR      DELEETIDREKRSRSDIEKSKRKVEGDLK-----------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      ----------------------------------------------------------------------
KI15B_XENLA     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ESKE--LERQNLETFK-DRMTEESKAELHAERIEALR---------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
MYSP_OPIFE      TDLEALRSQLEAERDNLASALHDAEEALRE----------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       QSLKEDLNKVRTEKETIQKDL-DAKIIDIQEKVKTITQVKKIGRRYKTQYEELK----------------
MYO2_CAEEL      EQLKESIEDEVAGKNEASRQLSKASVELDQWRTK------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     KNLEESLH----DKVSLAEEIEKLRSELDQMK--------------------------------------
KIF23_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     AAEFRRVSDEKMPEMTLRAMQENLSVTAQQQLSEKTKKLLKENERQLKRENDITEPLLHEM---------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       KNVKKEVHESESHQLALQKEVLMLKDKLEKSKRE------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ETYKSQVLKTRMEAADVAAKLEKCDNEKKALKDEMNKELELARKQFQSQLAELEK--LPEIL-----RIT
BRE1_DEBHA      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      DKTKRELETETASKIEMQRKMAD-----------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
K1C14_RAT       ATNSELVQSGKSEISELRRTMQNLEIELQSQLS---MKASLENNLEETKGRYCMQLAQQEMIGSVEEQLA
HOOK_CULQU      QAKLSAVQREKENLLSERDALREACDELK-----------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     EKLRAELDEKETERSDMKETIFELEDEVEQHRA-------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ENLKAKLHVKPEEHEQLKSRLEQKSGELGKRITE------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      QELKGNI---------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CN145_HUMAN     RTL-------KAESLEEKNMAKIHRGQLEKLKSQ------------------------------------
C117A_DANRE     ATVAAEFRRVSDEKM-------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
GOGC3_ARATH     QTALGQYYAEIEAKEHFERELAMAKDELMKLSARLKDSDERLESSNKEKEDVTSKLLHAEKVAAEWKNVT
CYTSA_PANTR     EKLRSDLDEKETERSDMKETIFELEDEVEQHRA-------------------------------------
CYTSA_HUMAN     EKLRSDLDEKETERSDMKETIFELEDEVEQHRA-------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ENLVDQLNKSQKENLELKEHIRQNEEELSRIRNELMQSLN------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      EDEIGDLH-EKNKQLQAKAQLQDEID--------------------------------------------
MDC1_PANTR      ----------------------------------------------------------------------
LIPA1_HUMAN     ESAKKQLEETQHDKDQLVLNIEALRAELDHMR---LRGASLHHGR-------------------------
KLP2_SCHPO      QKLESTVYTMKNKIIELEGILKSANVEVEKLIAEETLRRKLHNTIQELKGN-------------------
GCC2_MOUSE      ----------------------------------------------------------------------
CYTSA_MOUSE     EKLRSELEEKDTERSDMKETIFELEDEVEQHRA-------------------------------------
CYTSA_DANRE     VVIANDIKSEAQEEIDLRRRLQEAQEKNEK----------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     EEKLNVLQKEKEDKQETIDILRKELSRTEQIRKE------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      SDLKRTISKLEA---QVKQAEHESMLSLRNGAKVPERPSRSNS---------------------------
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      GRHGDDLRNTKSEIIELNRMIQRLRAEIE-----------------------------------------
K1C14_MOUSE     ATNSELVQSGKSEISELRRTMQNLEIELQSQLS---MKASLENNLEETKGRYCMQLAQQEMIGSVEEQLA
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     QKLMGQMHQLRSELQDMREQLQDLQDQIAKQR--------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     EELERTIHSYQGQVISHEKKAHDAARTLE-RNLNDLRKENAHNRQ-------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           QIEVAEPEWEDEGEPSPTRVARPNKRAVSYGNSGIESSTTSDAYQXXXXXXXXXXXXXXXVTTESEAFQT
APSA_EMENI      EVEIHDSDWENAGDISPTHKASNDSRD-RRGDQPIDD--RSDAYHATEADDPFETANERETTTESEAFQT
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      VQERYHIEWDEERDNHQKKIDSMN----------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      ----------------------------------------------------------------------
KI15B_XENLA     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ETQLAE----------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
K1C14_RAT       QL--------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
GOGC3_ARATH     KVEEDNAKVRRVLEQSMTRLNR------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      ----------------------------------------------------------------------
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     QL--------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           GTENFIDESSDDLTETESRTMHTGTIRPRRSGQLNSTRPMSFASTASTSGDEDEYIEVRTPVQHQPPRYR
APSA_EMENI      GVESMAGDSSDELTETEDRVQRTPRGRVSSMTLAKARDRXXXXXXXXXXXDEGDSTDPGTPSQFSTPRYR
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      ----------------------------------------------------------------------
KI15B_XENLA     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
K1C14_RAT       ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      ------------------------------------TRKSSRMTTFPATSAAPEPHPSTSTAQPVTPKPT
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           IKMSRGRRGRVSQESHIRQGSVPLSPRDSPASLNSPPQSPRQREISGGQSLFAELSGLAGAGSDSEFGAP
APSA_EMENI      LRKKRSRKIRPSGEAPMAFNSRPSSARESPSTSFTRDTSAAPE----GQSLFAELAEV--DGDEDDFGPP
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      ----------------------------------------------------------------------
KI15B_XENLA     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
K1C14_RAT       ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     ---------------------------------------------------------------------P
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      SQATRSRTNRSSVKTP--EQGVPTAPELQPCSTDQPVTSEPTSQVTRGRK---SRSSVKTPETVVPTALE
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           LRSSTMSEMSTPSRRQSFATLADSSRPVTAREIVMVDSCTMTEPLPPAVPAQFEIVSPPESTSDYKDAET
APSA_EMENI      MQFEAASP-STPSRRPSAVTVELPSKP------DMVDSGVMTDPWEPNLHLASQVISVPVT----PDKPT
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      ----------------------------------------------------------------------
KI15B_XENLA     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
K1C14_RAT       ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     AETNTMVPKTTPKFSHS---KSDTTLPVA-----------ITSPGPEASSA----VSTTTISPDMSDLVT
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      LQPSTSTDRPVTSEPTSHATRGRKNR----------SSVKTPEPVVPTAPE----LQPSTSTDQPVTSEP
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     ------------------------------------DSGALSPLLMPALDSG--TLSPLLSTSEYMSPGM
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     -----------------------------------------------------EPANPPEDSGGLKTRPD
MPP9_MOUSE      ----------------------------------------------------------------------
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           STAPREGVDAFTTFERIVVIDSATQCMPIETPLLAKSEPAVTIDIAPEIPDTDANHESLHATIETLPSPV
APSA_EMENI      MSDASTGMD---VVESPSLVHSSTQWTPLKPNAETSDDHVLSVPTPPKMADGQTLNEE---------RKV
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      ----------------------------------------------------------------------
KI15B_XENLA     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
K1C14_RAT       ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     SLVPSSGTDTSTTFPTL----SETPYEP-ETTVTWLTHPAETTTVSGTIPNFS------HRGSDTAPSMV
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      TTRGRKNRSSVKTPEPVV--PTAPELQPTDQPVTPKKNPESTVPIAPELPPSTSTEQPV------TPEPT
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     MTIPDFGTMSAT----LMVAPDSAEISPLAMP--APSSGVVCTPIM-----STSSSEAMSTPLMLAPSPI
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     STGPRPK-------------SGETTVQPCATAEVAPLEPHATAEVSPVQPQASAEV----TPVQPLPVSE
MPP9_MOUSE      ----------------------------------------------------------------------
MDC1_HUMAN      --------------------------------------PESTVPIAPELPPSTSTEQSSGKTPETLV-PT
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           MLPMEPTILDISPIYSEQTAPISPMPIDLQSRRPSVRMDMSVIAFEDSRPSLPAVTPSKSSLDLAMSSIQ
APSA_EMENI      DIPDSPTTLNISSVSFEETEPVAP----------------------------------------------
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      ----------------------------------------------------------------------
KI15B_XENLA     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
K1C14_RAT       ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     TSP---------GVDTRSGVPTTTIPPSI----PGVVTSQVTSSATDTSTAIPTLTPSPGEPETTASSTQ
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      SRATRETLVPTAPKLEPSTSTDQPVTPEPTSQATRGRTNRSSVKTPET------VVPTAPELQLSTSTDQ
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     LMQMNPGVMSTQPVPAPSSEAMSPLQITDEDTEAMSKVLMTALASGEISSLLMSGTDSEAISSLIMSAVA
PRAM_HUMAN      ---------------------------------------------------LPAAMESHQDFRSIKAKFQ
PHR4A_XENLA     VAPMQPLPVN-------EVAPMQPLPVN--EVAPKQPHHVSEVASVVSRPTSEVAPVQKVSRDFSKQPLL
MPP9_MOUSE      ----------------------------------------------------------------------
MDC1_HUMAN      APKLEPSTSTDQPVTPEPTSQATRG----RTNRSSVKTPETVV------PTAPELQPS------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           STSTNPLAVPVSLPESKRAQVLEFSTIFEVGTSPKEAIFPTVPPMTLEVSNIQCVESLPVKPVPTILSVE
APSA_EMENI      -------------------------------TAPKEAVIPPAPQLAL--STVSSVETPPVQPTPPALDEN
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      ----------------------------------------------------------------------
KI15B_XENLA     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
K1C14_RAT       ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     TGFTVPITVPSSEPDTMASWV-------------------------------------------------
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      AVTPKPXXXXVKNPES----TVPIAPELPPSTSTEQPVTPEPTSRATRGRKNRSSGKTPETLVPTAPKLE
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     SGGTSPQGIPTPLMSDLDSGIMSSLLM----SSPGSEVMST--PL-LSVPDAGEMSTLP-KPAPDAEAMS
PRAM_HUMAN      ASQPEPSDLPKKPPKPEFGKLKKFSQP-ELSEHPQKAPLPEFGAVSLKPPQPQFTD-LPKKPPPTDLPKK
PHR4A_XENLA     PPK-RPLSISTSVTQ-------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
MDC1_HUMAN      -TSTDQPVTPEPTSQATRGRTDRSSV------KTPETVVPTAPELQASASTDQPVTSEPTSSVKTPETVV
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           PPTDTLKLNGIEAQPCPPQVTDRATQSQISTMDRGISTSPLPKIETESQGSQTALTEVLETGERSSQVQI
APSA_EMENI      TPPSVMASTAKATKSAPPLVTDKGTADGLVTQQNGV-TLPLGAISGNA------------APRRARSGSS
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      ----------------------------------------------------------------------
KI15B_XENLA     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
K1C14_RAT       ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      PSTST-------DQPVTPEPTSQATRGR---TNRSSVKTPETVVPTAPELQPSTSTDQPVTPEPTSQVTR
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     PALMTALPSGVPTQTMPAPGSGAMSPWSTQNVDSEMMSNP-PVRATASGVMSAPPVRALDSGAMSTPLMG
PRAM_HUMAN      PPPP--EVTDLPKKPPPPEVTD------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
MDC1_HUMAN      PAAPELQPSTSTDQPVTPEPTSRATRGRTSSVKTPESIVPIPELQPSTSRNQLVTPE-------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           STAEISSQTILTGFQIDKLLMERQASRPVXXXXXXXXXXXXXXXXXXPLTTPKAKQLSSAQTGLLHPNNA
APSA_EMENI      NQADQGAQTILSSKQIDQLLIDRASVRPLSPPDSDKLNEMSNS----PFATPKARSVPQASNASLH----
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      ----------------------------------------------------------------------
KI15B_XENLA     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
K1C14_RAT       ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      GRTDRSS---------------------------------------------------------------
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     APASGNMSTL------------------------------------------------------------
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           TRRPGSSGSQRLGNSLSVPPLPVDHKQTIAAASQRLSSEASPSVMGPPIAPASSYRSSSQIRPRTPSEQP
APSA_EMENI      -KRPGSAASQ--ASSVQIPPLPADHKEAIMAAEKKSIDQASAGLMGPPLAPASAVRASSQQRPRTPNE--
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      ----------------------------------------------------------------------
KI15B_XENLA     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
K1C14_RAT       ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      ----------------------------------------------------------------------
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           SRNSARNQSTPQTKXXXXXXXXXXXXXXXXXXXXELDERFNIAKATYPFESGADPRMIQAITQTMIGEFL
APSA_EMENI      SALQVGSAKTTTSRAXXXXXXXXXXXXXXXXXXXELEERFNMQPAPQGYSTGTDPRMIQAITQTMIGEFL
NUM1_YEAST      -----------------------------------------------------EPSIIPALTQTVIGEYL
ANT1_ONCVO      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      ----------------------------------------------------------------MMGNEM
KI15B_XENLA     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
K1C14_RAT       ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      ----------------------------------------------------------------------
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           WKYTRKLGRSDMSNTRHQRYFWVNPYTRTLYWGPHDPQVLAKSQQRSKSVAIEAVRVVNDDNPYPPGLHR
APSA_EMENI      WKYTRRAVSGEISNTRHRRYFWVHPYTRTLYWSEHDPQSAGKSEGRTKSVSIEAVRVVADDNPYPPGLHC
NUM1_YEAST      FKYYPRLGPFGFES-RHERFFWVHPYTLTLYWSASNPILENPANTKTKGVAILGVESVTDPNPYPTGLYH
ANT1_ONCVO      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      MKYPRSESFK-MFKKSHWRYFWINPHCEMLCWSKTNPFIEKGRKNQVKSVKIKGMTIIKPDALKNANLHN
KI15B_XENLA     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
K1C14_RAT       ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      ----------------------------------------------------------------------
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           KSLEIITPGRTLKFTAATSQRHETWFNALSYLLLRTADDETEEQDVVWEAGSDYNATNGRNSRQAESRRS
APSA_EMENI      KSLEVVSPGRRIRFTATTSQRHETWFNALSYLLVRNGEDEEAENGVTLDDIDEFNPGFRSRSRQT-ARMS
NUM1_YEAST      KSIVVTTETRTIKFTCPTRQRHNIWYNSLRYLLQRNADDPTD----------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      EVIVMQTTDKPIVLKAKSKKIHNIWVQAIKQI--------------------------------------
KI15B_XENLA     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
K1C14_RAT       ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      ----------------------------------------------------------------------
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           ISSHNSRAARTISKQFVETVPTLRXXXXXXXXXXXXXXXXXXXXXXDQTRPGSVTRISNVFRSSGIKSTF
APSA_EMENI      VSSSQSRGTRGLPKQRSGSAMSLR-----PSVTPGRASPYPPSHYSDQARQASSSRLSTIFNST-IKGSF
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      ----------------------------------------------------------------------
KI15B_XENLA     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
K1C14_RAT       ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      ----------------------------------------------------------------------
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           SSRRSRYGNASGSIDSTSAASNDSAEELRRVIERQDREADRLENVRACCDGKHDVSALSRTSRYSARISP
APSA_EMENI      -GRKGPYAASSLNEDSIH-NHDDSVEDLRHMMDRGD-DVDRLENVRACCDGKHDVSSLSRTSRYSPRANR
NUM1_YEAST      ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MCP5_SCHPO      ----------------------------------------------------------------------
KI15B_XENLA     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
JIP_CAEEL       ----------------------------------------------------------------------
CC155_MOUSE     ----------------------------------------------------------------------
CC155_HUMAN     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
UN84B_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
CC155_BOVIN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
KIF23_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GOGA2_RAT       ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
C117B_DANRE     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH6_RABIT      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
K1C13_PROAT     ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ATG11_MAGGR     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYS2_DICDI      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
K1C14_RAT       ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
C117A_DANRE     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MDC1_PANTR      ----------------------------------------------------------------------
LIPA1_HUMAN     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CEP72_MOUSE     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
PRAM_HUMAN      ----------------------------------------------------------------------
PHR4A_XENLA     ----------------------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
MDC1_HUMAN      ----------------------------------------------------------------------
M5_STRP5        ----------------------------------------------------------------------
K2C3_HUMAN      ----------------------------------------------------------------------
K1C14_MOUSE     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           LSHHxxx
APSA_EMENI      ISHH---
NUM1_YEAST      -------
ANT1_ONCVO      -------
MYO3_CAEBR      -------
MYSC_CHICK      -------
MCP5_SCHPO      -------
KI15B_XENLA     -------
CENPF_HUMAN     -------
UACA_HUMAN      -------
CC150_HUMAN     -------
MLP2_YEAST      -------
JIP_CAEEL       -------
CC155_MOUSE     -------
CC155_HUMAN     -------
CING_DANRE      -------
ANR26_MOUSE     -------
UN84B_MOUSE     -------
MYO3_CAEEL      -------
CC155_BOVIN     -------
BPAEA_MOUSE     -------
CROCC_MOUSE     -------
MYH7_MOUSE      -------
MYH7_CANFA      -------
KI20B_MOUSE     -------
MYSP_OPIFE      -------
MYH7_PIG        -------
MYH7_HORSE      -------
MYH7_BOVIN      -------
TPR_HUMAN       -------
MYO2_CAEEL      -------
MYH7_RAT        -------
MOEH_ANOGA      -------
GOGA1_HUMAN     -------
EP15R_HUMAN     -------
MEDB_GIALA      -------
CP135_HUMAN     -------
KI15A_XENLA     -------
MYH6_MOUSE      -------
LIPA2_MOUSE     -------
KIF23_HUMAN     -------
HMW2_MYCPN      -------
GOGA2_RAT       -------
EP15R_MOUSE     -------
C117B_DANRE     -------
MYH7_MESAU      -------
MYH6_RAT        -------
MYH6_MESAU      -------
MRCKB_RAT       -------
GRDN_MOUSE      -------
CLIP2_HUMAN     -------
ANR26_HUMAN     -------
ODFP2_CHICK     -------
BRE1_DEBHA      -------
SGM1_YEAST      -------
MYH8_HUMAN      -------
MYH6_RABIT      -------
MYH11_CHICK     -------
LMNA_XENLA      -------
K1C13_PROAT     -------
MYH7_HUMAN      -------
CC150_MOUSE     -------
BPA1_HUMAN      -------
ATG23_DEBHA     -------
ATG11_MAGGR     -------
TG278_CAEEL     -------
MYSS_CYPCA      -------
MYS2_DICDI      -------
CING_XENTR      -------
C144A_HUMAN     -------
SPO15_SCHPO     -------
K1C14_RAT       -------
HOOK_CULQU      -------
GFAP_CARAU      -------
CYTSA_CHICK     -------
CNPD1_PEDPA     -------
BPAEA_HUMAN     -------
UACA_BOVIN      -------
SYCP1_MOUSE     -------
IFEB_HELPO      -------
ICR5_ARATH      -------
EVI5L_HUMAN     -------
CTK2_XENLA      -------
CING_SORAR      -------
SSP5_STRGN      -------
MUC16_HUMAN     -------
EBH_STAES       -------
EBH_STAEQ       -------
CN145_HUMAN     -------
C117A_DANRE     -------
UACA_CANFA      -------
PUMA_PARUN      -------
MYSP_SCHJA      -------
MYH2_HUMAN      -------
MYH2_CANFA      -------
MOEH_CULQU      -------
KIF4_DICDI      -------
GOGC3_ARATH     -------
CYTSA_PANTR     -------
CYTSA_HUMAN     -------
CTRO_MOUSE      -------
CP135_MOUSE     -------
CLIP1_CHICK     -------
CE57R_XENTR     -------
TRIPB_HUMAN     -------
SYGP1_HUMAN     -------
MYSN_ACACA      -------
MDC1_PANTR      -------
LIPA1_HUMAN     -------
KLP2_SCHPO      -------
GCC2_MOUSE      -------
CYTSA_MOUSE     -------
CYTSA_DANRE     -------
CP110_HUMAN     -------
CIP2A_MOUSE     -------
CEP72_MOUSE     -------
AGLZ_MYXXD      -------
SMC4_YEAST      -------
RGAG1_HUMAN     -------
PRAM_HUMAN      -------
PHR4A_XENLA     -------
MPP9_MOUSE      -------
MDC1_HUMAN      -------
M5_STRP5        -------
K2C3_HUMAN      -------
K1C14_MOUSE     -------
HMW2_MYCGA      -------
GOGB1_HUMAN     -------
GOGA5_MOUSE     -------
EVI5_MOUSE      -------
DAPLE_XENLA     -------
CTGE5_MOUSE     -------
CING_XENLA      -------
BICD2_MOUSE     -------