[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_02968

[Show Plain Result]


## Summary of Sequence Search
    1::963
   24::625     6e-22  23%  990 aa  KA111_SCHPO RecName: Full=Importin beta-like protein
  243::571     4e-11  20%  963 aa  IPO13_PONAB RecName: Full=Importin-13;         Short=Imp13;
  243::571     6e-11  20%  963 aa  IPO13_RAT RecName: Full=Importin-13;         Short=Imp13;AltName:
  243::571     6e-11  20%  963 aa  IPO13_MOUSE RecName: Full=Importin-13;         Short=Imp13;
  243::571     6e-11  20%  963 aa  IPO13_HUMAN RecName: Full=Importin-13;         Short=Imp13;AltName:
  243::571     2e-10  20%  963 aa  IPO13_BOVIN RecName: Full=Importin-13;         Short=Imp13;
  238::884     4e-10  24%  958 aa  IPO13_CHICK RecName: Full=Importin-13;         Short=Imp13;
   14::584     7e-10  23%  972 aa  MTR10_YEAST RecName: Full=mRNA transport regulator MTR10;
  398::834     7e-09  25% 1081 aa  PDR6_YEAST RecName: Full=Pleiotropic drug resistance regulatory
   45::601     3e-06  27% 1064 aa  IP13A_DICDI RecName: Full=Importin-13 homolog A;
  392::531     4e-06  26%  923 aa  TNPO3_MOUSE RecName: Full=Transportin-3;
  392::531     8e-06  26%  923 aa  TNPO3_HUMAN RecName: Full=Transportin-3;AltName:
  391::580     3e-04  23%  955 aa  YNR7_SCHPO RecName: Full=Uncharacterized protein C11G11.07;
   94::235     5e-04  31% 1119 aa  IP13B_DICDI RecName: Full=Inportin-13 homolog B;
    1::963

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxQVLSAPGNASFVQTAQARLQTLQKSAAGWAIADSLLGSEDANVRFYGALTLT
KA111_SCHPO     ---------------------------SAIAATEKELQKAQRSQQGWNIGLFMLQSKDVYEQFFGALTLQ
IPO13_PONAB     ----------------------------------------------------------------------
IPO13_RAT       ----------------------------------------------------------------------
IPO13_MOUSE     ----------------------------------------------------------------------
IPO13_HUMAN     ----------------------------------------------------------------------
IPO13_BOVIN     ----------------------------------------------------------------------
IPO13_CHICK     ----------------------------------------------------------------------
MTR10_YEAST     ------------------QCISSTASQDDKNKALQFLEQFQRSTVAWSICNEILSKEDPTLNIFAAQTLR
PDR6_YEAST      ----------------------------------------------------------------------
IP13A_DICDI     ---------------------------------QQWLIQFQKSFSSWSIAPLLLMSNIKEIQYFGASTIE
TNPO3_MOUSE     ----------------------------------------------------------------------
TNPO3_HUMAN     ----------------------------------------------------------------------
YNR7_SCHPO      ----------------------------------------------------------------------
IP13B_DICDI     --------------------------------AEKWLILFQKQPIAWEFCPRLLLETNIELQYFGASTLE


                         .         .         *         .         .         .         .:140
query           MKIHQDWANLGEQMVRDLLIRLVDCFLLLVNKNETPVVMRKFITSMTAMFFKPQAPWTHCIRHVAISLAN
KA111_SCHPO     MKINTQLETLSDDGLPALVERKVICTLALEKKEEASLKVIYCLFCNKLEFFNADMN--------AASVLN
IPO13_PONAB     ----------------------------------------------------------------------
IPO13_RAT       ----------------------------------------------------------------------
IPO13_MOUSE     ----------------------------------------------------------------------
IPO13_HUMAN     ----------------------------------------------------------------------
IPO13_BOVIN     ----------------------------------------------------------------------
IPO13_CHICK     ----------------------------------------------------------------------
MTR10_YEAST     NKVTYDLSQLENNLFKDSLLTL----LLSHNQKLIITQLNVALARLAIQFLEWQNPIFEXXXXXXXXXXX
PDR6_YEAST      ----------------------------------------------------------------------
IP13A_DICDI     NKIKNNWLSLSQDMKKEFLDNLLLFLKTQITKCSTVVITR------------------------------
TNPO3_MOUSE     ----------------------------------------------------------------------
TNPO3_HUMAN     ----------------------------------------------------------------------
YNR7_SCHPO      ----------------------------------------------------------------------
IP13B_DICDI     SKLKNEWNECNVEMKSKILNTIVS---IIQNSTKLPIVTRVSVTLTIAVMYTFPEIWRNAIIHLSIK---


                         +         .         .         .         .         *         .:210
query           GKYLPEEQADLQSFQTLVLPSLNYDRLLAVMSFSTTLAEESVRHAQNSSGYQDRLTANMNDAFFLINYSF
KA111_SCHPO     NLFPPASSRNAQ------LTASYINELLLELSFSIYTKENEDALFNNVFRPCSNIIVSVL-VFIFTNYSL
IPO13_PONAB     ----------------------------------------------------------------------
IPO13_RAT       ----------------------------------------------------------------------
IPO13_MOUSE     ----------------------------------------------------------------------
IPO13_HUMAN     ----------------------------------------------------------------------
IPO13_BOVIN     ----------------------------------------------------------------------
IPO13_CHICK     ----------------------------------------------------------------------
MTR10_YEAST     XRILPEETLDIASTS---LTEVEFNS--RIHELIDPIAEDVLKFLVSCIDLLQNTDGNSSSSI-----SL
PDR6_YEAST      ----------------------------------------------------------------------
IP13A_DICDI     ----------------------------------------------------------------------
TNPO3_MOUSE     ----------------------------------------------------------------------
TNPO3_HUMAN     ----------------------------------------------------------------------
YNR7_SCHPO      ----------------------------------------------------------------------
IP13B_DICDI     -----------QDINTLSLPSQNHDRLLMVLEFLSILPDE------------------------------


                         .         .         .         +         .         .         .:280
query           QRXXXXXXXXXXXXXXDQPTNTAQEAISSLQAWITAMRSVRVDRGALSSAVNVPISCAIRFLSEPRLAPN
KA111_SCHPO     D------------LSKEKNVAALEEALNCMIAISSYLAKASVSVQSVLPAFTECMDLTVNCIALDEVSEK
IPO13_PONAB     ------------------------------------------------------IQAAFAALQDSELFDS
IPO13_RAT       ------------------------------------------------------IQAAFAALQDSELFDS
IPO13_MOUSE     ------------------------------------------------------IQAAFAALQDSELFDS
IPO13_HUMAN     ------------------------------------------------------IQAAFAALQDSELFDS
IPO13_BOVIN     ------------------------------------------------------IQAAFAALQDSELFDS
IPO13_CHICK     ------------------------------------------------------IQAAFTSLQDPELFDT
MTR10_YEAST     EQILRCLNSWSYEFPVEQLL-TVQPLINLV--FETISNGNESDMEAFDSAID----CLCVILRESRDTTN
PDR6_YEAST      ----------------------------------------------------------------------
IP13A_DICDI     ----------------------------------------------------------------------
TNPO3_MOUSE     ----------------------------------------------------------------------
TNPO3_HUMAN     ----------------------------------------------------------------------
YNR7_SCHPO      ----------------------------------------------------------------------
IP13B_DICDI     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TMELLTDIILSQPKLLTPDHFTGIMDFLIGSDGEQYAMAILNGEFEDDQMRFLELLLRFASSETQIRVLT
KA111_SCHPO     AMNCLADLLANYSNFITQPTIERLWTILTGPWGETHLQQELEDSGEENDYSFLNIVIGFAEAMLP-QIID
IPO13_PONAB     SVEAIVNAISQPDAQRCVNTLLKLIPLVLGLQ-EQLRQAVQNGDMETSHGI---CRIAVALGENHSRALL
IPO13_RAT       SVEAIVNAISQPDAQRYVNTLLKLIPLVLGLQ-EQLRQAVQNGDMETSHGI---CRIAVALGENHSRALL
IPO13_MOUSE     SVEAIVNAISQPDAQRYVNTLLKLIPLVLGLQ-EQLRQAVQNGDMETSHGI---CRIAVALGENHSRALL
IPO13_HUMAN     SVEAIVNAISQPDAQRYVNTLLKLIPLVLGLQ-EQLRQAVQNGDMETSHGI---CRIAVALGENHSRALL
IPO13_BOVIN     SVEAIVNAISQPDAQRYVNTLLKLIPLVLGLQ-DQLRQAVQNGDMETSHGI---CRIAVALGENHSRALL
IPO13_CHICK     AVEAVVNAISQPDAQRYVNTLLKLIPPVLGLQ-EQLRQAVQSGDMETSHGI---CRIAVALGENHSRALL
MTR10_YEAST     EQALFHQLMLLQEKLL-PTLFTDHP---------------LNDEYDDDLLEGMTRLFVEAGEAWSV-VIS
PDR6_YEAST      ----------------------------------------------------------------------
IP13A_DICDI     ----------------------------------------------------------------------
TNPO3_MOUSE     ----------------------------------------------------------------------
TNPO3_HUMAN     ----------------------------------------------------------------------
YNR7_SCHPO      ----------------------------------------------------------------------
IP13B_DICDI     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           HSPDEKHERILFLLFKLFHAPGVGAVEDMASNLLLEFWTEAADNISELIMEGAFDEPTLSVKENFTRVIA
KA111_SCHPO     HIQEEKSIRLLYILASLLSFPGYAIVEEKVSWRTLEFWTTLIEDFS---MSKAATDPSKDFKQIAFSVVE
IPO13_PONAB     DQVEHWQSFLALVNMIMFCTPGHYPVNETTSSLTLTFWYTLQDDILEAEKQAVYQQVYRPV---YFQLVD
IPO13_RAT       DQVEHWQSFLALVNMIMFCTPGHYPVNETTSSLTLTFWYTLQDDILEAEKQAVYQQVYRPV---YFQLVD
IPO13_MOUSE     DQVEHWQSFLALVNMIMFCTPGHYPVNETTSSLTLTFWYTLQDDILEAEKQAVYQQVYRPV---YFQLVD
IPO13_HUMAN     DQVEHWQSFLALVNMIMFCTPGHYPVNETTSSLTLTFWYTLQDDILEAEKQAVYQQVYRPV---YFQLVD
IPO13_BOVIN     DQVEHWQSFLALVNMIMFCTPGHFPVNETTSSLTLTFWYTLQDDILEAEKQAVYQQVYRPV---YFQLVD
IPO13_CHICK     DQVEHWQSFLALVNMIMFCTPGHYPVNETTSSLTLTFWYTLQDDIL------SFEPDKQAVYQQVYRLVD
MTR10_YEAST     KNPDFFKPMVLVLLMLTCKNEDLDVV-----SYTFPFWF----NFKQSLVLPRYQESRKAYSDIFVKLIN
PDR6_YEAST      ---DEYIQEYIKVLLQMTNFPLTPVLQEFFSVRMVDFWLDLSDAYTNLASETLRPNSIELSTQIFQQLIN
IP13A_DICDI     ----------------------------------------------------------------------
TNPO3_MOUSE     ----------------------------------------------------------------------
TNPO3_HUMAN     ----------------------------------------------------------------------
YNR7_SCHPO      ----------------------------------------------------------------------
IP13B_DICDI     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ECFDKFRYPNPSVLSEWEDDDVKIFNTFRRDFSDFLLATYPLLGVPMIQQIQERAAVAIRDHDWERFEVA
KA111_SCHPO     KAWWKMLLPSPEQWNSWPSSSRDSFNSYRRDLGDLLESSYSIFGERLYAMYITTIENFFSDGTGQSLEVS
IPO13_PONAB     VLLHKAQFPSDEEYGFWSSDEKEQFRIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLEPYSWQHTEAL
IPO13_RAT       VLLHKAQFPSDEEYGFWSSDEKEQFRIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLEPYSWQHTEAL
IPO13_MOUSE     VLLHKAQFPSDEEYGFWSSDEKEQFRIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLEPYSWQHTEAL
IPO13_HUMAN     VLLHKAQFPSDEEYGFWSSDEKEQFRIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLEPYSWQHTEAL
IPO13_BOVIN     VLLHKAQFPSDEEYGFWSSDEKEQFRIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLEPYSWQHTEAL
IPO13_CHICK     VLLHKAQFPSDEEYGFWSSDEKEQFRIYRVDISDTLMYVYEMLGAELLSSLYDKLGRLLTNTEWQHTEAL
MTR10_YEAST     GIITHLQYPSGQFSSKEEEDK---FKDFRYHMGDVLKDCTAVVGTEALSQPLIRIKSAIENNNWQIMEAP
PDR6_YEAST      IYLPKISLSVKQRIIEEEGESTSVFEDFRNAVSDLAQSLWSILGNDNLTNVQMPAALIIKDTDLFRIETM
IP13A_DICDI     ----KSMYPLDKDISDLYEEDAEKFFAFRVIAGDSVLEVYNILEGKILQQLLNSLWSDIQSFPWQSIEAT
TNPO3_MOUSE     -----------------ETDD---FGEFRMRVSDLVKDLIFLIG-SMECFAQLYSTLKEGNPPWEVTEAV
TNPO3_HUMAN     -----------------ETDD---FGEFRMRVSDLVKDLIFLIG-SMECFAQLYSTLKEGNPPWEVTEAV
YNR7_SCHPO      ----------------FEDRDAEDFRSFRHEMGDVLKDCCVVAGVSSLVQISSQLIKVLKIKEWQDVEAP
IP13B_DICDI     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           MFCLASLADTIAENKHADDLLHALFHSELFDAICFGRTDIPLKTRQTLSDMIAKYTPYFERNHNLLAPVL
KA111_SCHPO     FYCLCCILEDTNDSDTLDAWLTRLFETSFAIKASAFQNPXXXXXXXXXXXXXXXXXXNHPQYLNISLPVL
IPO13_PONAB     LYGFQSIAETIDVN--YSDVVPGLI--GLIPRISISNVQL----ADTVMFTIGALSEWLADHPVMINSVL
IPO13_RAT       LYGFQSIAETIDVN--YSDVVPGLI--GLIPRISISNVQL----ADTVMFTIGALSEWLADHPVMINSVL
IPO13_MOUSE     LYGFQSIAETIDVN--YSDVVPGLI--GLIPRISISNVQL----ADTVMFTIGALSEWLADHPVMINSVL
IPO13_HUMAN     LYGFQSIAETIDVN--YSDVVPGLI--GLIPRISISNVQL----ADTVMFTIGALSEWLADHPVMINSVL
IPO13_BOVIN     LYGFQSIAETIDVN--YSDVVPGLI--GLIPRISISNVQL----ADTVMFTIGALSEWLADHPVMINSVL
IPO13_CHICK     LYGFQSIAETIDVN--YSDVVPGLI--GLIPRISISNVQL----ADTVMFTIGALSEWLADHPVMINNVL
MTR10_YEAST     LFSLRTMAKEIS-------LTENTILPEIIKIICNLPEQAKIRYASTL--VLGRYTEWTAKHPELLEVQL
PDR6_YEAST      CFVLNTLVDTLSESPWIKNIVDAFFNQNVISVFQTGQTSASTKVSQILTTLIGTLAGYFKQEPFQLNPYV
IP13A_DICDI     IYLLSCLSESITEDTE--------FVPQLFSIL--GQLPIQIKSTMTLA---GNYSNLIDKSTIFLEKIV
TNPO3_MOUSE     LFIMAAIAKSVDPENNPTLV-------EVLEGVVHLPETVHTAVRYTSIELVGEMSEVVDRNPQFLDPVL
TNPO3_HUMAN     LFIMAAIAKSVDPENNPTLV-------EVLEGVVRLPETVHTAVRYTSIELVGEMSEVVDRNPQFLDPVL
YNR7_SCHPO      LFALRAIGRMVPANE--DQVIGSLFQ-------ILPQLPENNKVRYAATLFLGRYTEWTAQHSEFLELQL
IP13B_DICDI     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           NFLFSSLGMPSSEQAAAKSISSLCGTCRQPLTIYVEEFISKFAQLHANPSTNGHTLERVVEGIASVIQAV
KA111_SCHPO     -FDALHISETSIQMTVSRSIHTLCTTCASHLLTEIDGFMAVVEELTPKLVYVPSVLEKIYSSVGYVTQRI
IPO13_PONAB     PLVLHALGNPEPSVSSVSTLKKICRECKYDLPPYAANIVA------------------------------
IPO13_RAT       PLVLHALGNPELSVSSVSTLKKICRECKYELPPYAANIVA------------------------------
IPO13_MOUSE     PLVLHALGNPELSVSSVSTLKKICRECKYDLPPYAANIVA------------------------------
IPO13_HUMAN     PLVLHALGNPELSVSSVSTLKKICRECKYDLPPYAANIVA------------------------------
IPO13_BOVIN     PLVLHALGNPELSISSVSTLKKICRECKYDLPPYAANIVA------------------------------
IPO13_CHICK     PLVLQALGNPELSISSVSTLKKICRECKYDLPPYAANIVA------------------------------
MTR10_YEAST     QYIFNSSDMQSIITASSHALMFFCSDCSKLLVGYIDQLINFF--LNVQSSIDIESQFELCQGLSAVI---
PDR6_YEAST      EALFQGLHTCTNEVMVIKTVSTLCETCREELTPYLMHFISFLNTVIMPDSNVSHTRTKLVRSIGYVVQCQ
IP13A_DICDI     KDFFPAFENPDLKSVASQSFLSISSKCASILSNSITQLISLCAPILSN----------------------
TNPO3_MOUSE     GYLMKGLCEKPLASAAAKAIHNICSVCR------------------------------------------
TNPO3_HUMAN     GYLMKGLCEKPLASAAAKAIHNICSVCR------------------------------------------
YNR7_SCHPO      NYISAGFEVANKESAAAQALKHFCYDCREQLVGHLSQL--HMFYLNAKTYLAPDPLMEVAQGLAHIV---
IP13B_DICDI     ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           GSEXXXXXXXXXXXXXXCQEAKQARDISRTGQHEAGLASGFRVMGCTASIGKGLRAPEEFCINLDEESPD
KA111_SCHPO     ----------------------------------------------------------------------
IPO13_PONAB     ----------------------------------------------------------------------
IPO13_RAT       ----------------------------------------------------------------------
IPO13_MOUSE     ----------------------------------------------------------------------
IPO13_HUMAN     ----------------------------------------------------------------------
IPO13_BOVIN     ----------------------------------------------------------------------
IPO13_CHICK     ----------------------------------------------------------------------
MTR10_YEAST     ----------------------------------------------------------------------
PDR6_YEAST      VSNGPE------------EQAKYILQLTNSGSIEHCLASSVQLLYCISELATSLIQPTEIIEN-DALLQR
IP13A_DICDI     ----------------------------------------------------------------------
TNPO3_MOUSE     ----------------------------------------------------------------------
TNPO3_HUMAN     ----------------------------------------------------------------------
YNR7_SCHPO      ----------------------------------------------------------------------
IP13B_DICDI     ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           RSAESDFWTGDPRATSLQSLIIQILEHLVNEFCADGDIIEGACDVLKAGxxxxxxxxxxxxxxxxxxxxx
KA111_SCHPO     ----------------------------------------------------------------------
IPO13_PONAB     ----------------------------------------------------------------------
IPO13_RAT       ----------------------------------------------------------------------
IPO13_MOUSE     ----------------------------------------------------------------------
IPO13_HUMAN     ----------------------------------------------------------------------
IPO13_BOVIN     ----------------------------------------------------------------------
IPO13_CHICK     ----------------------------------------------------------------------
MTR10_YEAST     ----------------------------------------------------------------------
PDR6_YEAST      LSEFQSFWSSDPLRSKIMCTIDKVLDNSI--YCKNSAFVEIGCLIVGKG---------------------
IP13A_DICDI     ----------------------------------------------------------------------
TNPO3_MOUSE     ----------------------------------------------------------------------
TNPO3_HUMAN     ----------------------------------------------------------------------
YNR7_SCHPO      ----------------------------------------------------------------------
IP13B_DICDI     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxSFFSLIEAPQDKPEVVQAILHFTLVTLKGPDTLPLRAACSFWTTLLGLHDLPPAFTPDGLYKGQEQTA
KA111_SCHPO     ----------------------------------------------------------------------
IPO13_PONAB     ----------------------------------------------------------------------
IPO13_RAT       ----------------------------------------------------------------------
IPO13_MOUSE     ----------------------------------------------------------------------
IPO13_HUMAN     ----------------------------------------------------------------------
IPO13_BOVIN     ----------------------------------------------------------------------
IPO13_CHICK     --SFMQLLQALKRKPDLVKALFHCGVLSLKFPEAPTVKASCGFFTELLRCGEIAPV--------GQVVHE
MTR10_YEAST     ----------------------------------------------------------------------
PDR6_YEAST      ----------------------------------------------------------------------
IP13A_DICDI     ----------------------------------------------------------------------
TNPO3_MOUSE     ----------------------------------------------------------------------
TNPO3_HUMAN     ----------------------------------------------------------------------
YNR7_SCHPO      ----------------------------------------------------------------------
IP13B_DICDI     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           TAKPFDAYLAQLGDVVISQIAGKCARSELDHFSEVIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KA111_SCHPO     ----------------------------------------------------------------------
IPO13_PONAB     ----------------------------------------------------------------------
IPO13_RAT       ----------------------------------------------------------------------
IPO13_MOUSE     ----------------------------------------------------------------------
IPO13_HUMAN     ----------------------------------------------------------------------
IPO13_BOVIN     ----------------------------------------------------------------------
IPO13_CHICK     NGK-------VLLQAVLEGVGGQASRSLMDHFAEIL----------------------------------
MTR10_YEAST     ----------------------------------------------------------------------
PDR6_YEAST      ----------------------------------------------------------------------
IP13A_DICDI     ----------------------------------------------------------------------
TNPO3_MOUSE     ----------------------------------------------------------------------
TNPO3_HUMAN     ----------------------------------------------------------------------
YNR7_SCHPO      ----------------------------------------------------------------------
IP13B_DICDI     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KA111_SCHPO     -----------------------------------------------------
IPO13_PONAB     -----------------------------------------------------
IPO13_RAT       -----------------------------------------------------
IPO13_MOUSE     -----------------------------------------------------
IPO13_HUMAN     -----------------------------------------------------
IPO13_BOVIN     -----------------------------------------------------
IPO13_CHICK     -----------------------------------------------------
MTR10_YEAST     -----------------------------------------------------
PDR6_YEAST      -----------------------------------------------------
IP13A_DICDI     -----------------------------------------------------
TNPO3_MOUSE     -----------------------------------------------------
TNPO3_HUMAN     -----------------------------------------------------
YNR7_SCHPO      -----------------------------------------------------
IP13B_DICDI     -----------------------------------------------------