[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_02972

[Show Plain Result]


## Summary of Sequence Search
    1::134
    7::138     1e-30  44%  139 aa  ASPH_ASPFU RecName: Full=Asp-hemolysin;         Short=Asp-HS;Flags:
   10::144     1e-25  38%  145 aa  AAPR1_AGRAE RecName: Full=Aegerolysin Aa-Pri1;Flags: Precursor;
    2::46      6e-08  44%   50 aa  OSTL_PLEOS RecName: Full=Ostreolysin;Flags: Fragment;
  164::265     6e-04  37%  713 aa  PNP_AMOA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
    1::134

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxYQQWVIVKITNSTNKALKIANLRLMYGKIHREGNKDEEISADDVDSTEIAPNATYTLCTCGRSDSPSG
ASPH_ASPFU      --YAQWVTVHLINSSSETLSIQNASLSWGKWYKDGDKDAEITSEDVQQKTAPPGGSVNVNSCGRSDASSG
AAPR1_AGRAE     --YAQWVIIILHNVGSSPFKIANLGLSWGKLYADGNKDKEVYPSDYNGKTVGPDEKIQINSCGRENASSG
OSTL_PLEOS      --YAQWVIIIIHNVGSQDVKIKNLKASWGKLHADGDKDAEVSASNYE-----------------------
PNP_AMOA5       ----------VVNPTQSALEKADIDLMVGGSEKEGEMDEVQEADIIAAIQFAHEAIKLQC----------


                         .         .         *         .         .         .         .:140
query           AEGALQLMQEQAAVCTLYWDCPWGSKTNNFEVQDRNKQYVVSAEGWVREGGALGTAEVEVFKKG
ASPH_ASPFU      TTGGFDLYDGNTKIGRVHWDCPWGSKTNDFDVGERNKNYWVEIGTWNKYGGAIGTVDVEVGRK-
AAPR1_AGRAE     TEGSFDIVDPNDGNKTIYWECPWGSKRNTWTPSGSNTKWMVEWSGQNLDSGALGTITVDVLRKG
OSTL_PLEOS      ----------------------------------------------------------------
PNP_AMOA5       -----QVQKELAAVATLKFEAEPLQETENFELKDRDKVYATAKKG-------------------