[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_10408

[Show Plain Result]


## Summary of Sequence Search
    1::221
   44::220     3e-21  31%  224 aa  CRP_HAEIN RecName: Full=Catabolite gene activator;AltName:
   30::206     6e-20  30%  210 aa  CRP_SHIFL RecName: Full=Catabolite gene activator;AltName:
   30::206     6e-20  30%  210 aa  CRP_SALTY RecName: Full=Catabolite gene activator;AltName:
   30::206     6e-20  30%  210 aa  CRP_KLEAE RecName: Full=Catabolite gene activator;AltName:
   30::206     6e-20  30%  210 aa  CRP_ECOLI RecName: Full=Catabolite gene activator;AltName:
   30::206     6e-20  30%  210 aa  CRP_ECOL6 RecName: Full=Catabolite gene activator;AltName:
   30::206     6e-20  30%  210 aa  CRP_ECO57 RecName: Full=Catabolite gene activator;AltName:
   29::205     9e-19  30%  209 aa  CRP_PASMU RecName: Full=Catabolite gene activator;AltName:
   31::210     4e-17  30%  214 aa  VFR_PSEAE RecName: Full=Cyclic AMP receptor-like protein;
   22::215     1e-16  24%  238 aa  FNR_BACSU RecName: Full=Anaerobic regulatory protein;
   26::213     6e-15  26%  222 aa  NTCA_SYNE7 RecName: Full=Global nitrogen regulator;
   32::214     2e-13  26%  225 aa  NTCA_SYNY3 RecName: Full=Global nitrogen regulator;
   30::212     4e-13  31%  223 aa  NTCA_ANAVT RecName: Full=Global nitrogen regulator;AltName:
   30::212     4e-13  31%  223 aa  NTCA_ANASP RecName: Full=Global nitrogen regulator;AltName:
   10::214     2e-12  29%  219 aa  FLP_LACCA RecName: Full=Probable transcriptional regulator flp;
   45::226     6e-12  28%  230 aa  CLP_XANCP RecName: Full=Catabolite activation-like protein;AltName:
  231::299     5e-11  42%  330 aa  Y2593_MYCBO RecName: Full=Uncharacterized ABC transporter
  231::299     5e-11  42%  330 aa  Y2564_MYCTU RecName: Full=Uncharacterized ABC transporter
  232::315     7e-11  39%  466 aa  KAPR_KLULA RecName: Full=cAMP-dependent protein kinase regulatory
  857::926     9e-11  36% 1521 aa  NTE1_CHAGB RecName: Full=Lysophospholipase NTE1;       
  143::241     2e-10  38%  375 aa  KAPR_YARLI RecName: Full=cAMP-dependent protein kinase regulatory
  223::312     2e-10  38%  458 aa  KAPR_ASHGO RecName: Full=cAMP-dependent protein kinase regulatory
  866::938     3e-10  32% 1527 aa  NTE1_ASPTN RecName: Full=Lysophospholipase nte1;       
   66::154     3e-10  34%  327 aa  KAPR_DICDI RecName: Full=cAMP-dependent protein kinase regulatory
  184::284     3e-10  36%  416 aa  KAPR_YEAST RecName: Full=cAMP-dependent protein kinase regulatory
  156::250     4e-10  35%  403 aa  KAPR_BLAEM RecName: Full=cAMP-dependent protein kinase regulatory
  134::237     6e-10  34%  378 aa  KAPR_APLCA RecName: Full=cAMP-dependent protein kinase regulatory
  855::924     2e-09  33% 1515 aa  NTE1_NEUCR RecName: Full=Lysophospholipase nte-1;       
  333::425     2e-09  32%  462 aa  KAPR_TRIAT RecName: Full=cAMP-dependent protein kinase regulatory
  234::337     2e-09  30%  355 aa  CNGK1_RHILO RecName: Full=Cyclic nucleotide-gated potassium channel
  880::948     2e-09  32% 1538 aa  NTE1_ASPOR RecName: Full=Lysophospholipase nte1;       
  866::938     2e-09  30% 1528 aa  NTE1_ASPCL RecName: Full=Lysophospholipase nte1;       
  170::270     2e-09  35%  404 aa  KAPR_CANGA RecName: Full=cAMP-dependent protein kinase regulatory
  908::980     4e-09  30% 1569 aa  NTE1_COCIM RecName: Full=Lysophospholipase NTE1;       
  160::254     4e-09  37%  411 aa  KAPR_ASPNG RecName: Full=cAMP-dependent protein kinase regulatory
  238::326     6e-09  33%  377 aa  KAPR2_DROME RecName: Full=cAMP-dependent protein kinase type II
  233::322     6e-09  30%  355 aa  CNGK1_RHIEC RecName: Full=Cyclic nucleotide-gated potassium channel
  149::245     8e-09  34%  416 aa  KAP3_RAT RecName: Full=cAMP-dependent protein kinase type II-beta
  149::245     8e-09  34%  416 aa  KAP3_MOUSE RecName: Full=cAMP-dependent protein kinase type II-beta
  151::247     8e-09  34%  418 aa  KAP3_BOVIN RecName: Full=cAMP-dependent protein kinase type II-beta
  289::392     1e-08  31%  412 aa  KAPR_EMENI RecName: Full=cAMP-dependent protein kinase regulatory
   47::230     1e-08  22%  244 aa  FNRA_PSEST RecName: Full=Transcriptional activator protein fnrA;
  269::377     1e-08  28%  412 aa  Y4233_RHOPA RecName: Full=Putative potassium channel protein
  866::938     1e-08  27% 1527 aa  NTE1_EMENI RecName: Full=Lysophospholipase nte1;       
  121::210     1e-08  34%  369 aa  KAPR_STRPU RecName: Full=cAMP-dependent protein kinase type II
  151::247     1e-08  34%  418 aa  KAP3_HUMAN RecName: Full=cAMP-dependent protein kinase type II-beta
  873::941     2e-08  29% 1531 aa  NTE1_ASPNC RecName: Full=Lysophospholipase nte1;       
  137::237     2e-08  33%  381 aa  KAP0_PONAB RecName: Full=cAMP-dependent protein kinase type I-alpha
  137::237     2e-08  33%  381 aa  KAP0_HUMAN RecName: Full=cAMP-dependent protein kinase type I-alpha
  162::255     2e-08  34%  413 aa  KAPR_ASPFU RecName: Full=cAMP-dependent protein kinase regulatory
   52::232     2e-08  23%  239 aa  AADR_RHOPA RecName: Full=Transcriptional activatory protein
  132::235     3e-08  32%  376 aa  KAPR1_DROME RecName: Full=cAMP-dependent protein kinase type I
  137::237     3e-08  32%  381 aa  KAP0_RAT RecName: Full=cAMP-dependent protein kinase type I-alpha
  137::237     3e-08  32%  381 aa  KAP0_MOUSE RecName: Full=cAMP-dependent protein kinase type I-alpha
  136::236     3e-08  32%  380 aa  KAP0_BOVIN RecName: Full=cAMP-dependent protein kinase type I-alpha
   34::206     3e-08  26%  211 aa  FIXK_RHIME RecName: Full=Nitrogen fixation regulation protein fixK;
  861::933     4e-08  29% 1523 aa  NTE1_NEOFI RecName: Full=Lysophospholipase nte1;       
  841::910     4e-08  29% 1503 aa  NTE1_MAGGR RecName: Full=Lysophospholipase NTE1;       
  136::219     5e-08  36%  380 aa  KAP0_PIG RecName: Full=cAMP-dependent protein kinase type I-alpha
   21::129     7e-08  27%  583 aa  Y2594_MYCBO RecName: Full=Uncharacterized NTE family protein
   21::129     7e-08  27%  583 aa  Y2565_MYCTU RecName: Full=Uncharacterized NTE family protein
  402::507     7e-08  27%  828 aa  SKOR_ARATH RecName: Full=Potassium channel SKOR;AltName:
  235::322     7e-08  31%  686 aa  KGP1B_MOUSE RecName: Full=cGMP-dependent protein kinase 1, beta
  235::322     7e-08  31%  686 aa  KGP1B_BOVIN RecName: Full=cGMP-dependent protein kinase 1, beta
  220::307     7e-08  31%  671 aa  KGP1A_MOUSE RecName: Full=cGMP-dependent protein kinase 1, alpha
  220::307     7e-08  31%  671 aa  KGP1A_BOVIN RecName: Full=cGMP-dependent protein kinase 1, alpha
  261::355     9e-08  31%  391 aa  KAPR_GLOLA RecName: Full=cAMP-dependent protein kinase regulatory
  213::297     9e-08  32%  452 aa  KAPR_DEBHA RecName: Full=cAMP-dependent protein kinase regulatory
  138::238     9e-08  32%  382 aa  KAP0_CHICK RecName: Full=cAMP-dependent protein kinase type I-alpha
  122::205     1e-07  36%  366 aa  KAPR_CAEEL RecName: Full=cAMP-dependent protein kinase regulatory
   45::230     1e-07  21%  242 aa  BTR_BORPE RecName: Full=Transcriptional regulatory protein btr;
  133::229     2e-07  31%  401 aa  KAP2_RAT RecName: Full=cAMP-dependent protein kinase type II-alpha
   47::230     2e-07  27%  244 aa  ANR_PSEAE RecName: Full=Transcriptional activator protein anr;
  615::689     2e-07  29% 1349 aa  PLPL7_RAT RecName: Full=Patatin-like phospholipase
  137::237     2e-07  33%  381 aa  KAP1_RAT RecName: Full=cAMP-dependent protein kinase type I-beta
  137::237     2e-07  33%  381 aa  KAP1_MOUSE RecName: Full=cAMP-dependent protein kinase type I-beta
  644::714     3e-07  31% 1365 aa  PLPL6_PONAB RecName: Full=Neuropathy target esterase;       
  634::704     3e-07  31% 1355 aa  PLPL6_MOUSE RecName: Full=Neuropathy target esterase;       
  644::714     3e-07  31% 1366 aa  PLPL6_HUMAN RecName: Full=Neuropathy target esterase;       
  137::237     3e-07  33%  381 aa  KAP1_HUMAN RecName: Full=cAMP-dependent protein kinase type I-beta
  594::699     3e-07  31% 1198 aa  HCN4_RAT RecName: Full=Potassium/sodium hyperpolarization-activated
  595::700     3e-07  31% 1175 aa  HCN4_RABIT RecName: Full=Potassium/sodium
  594::699     3e-07  31% 1186 aa  HCN4_MOUSE RecName: Full=Potassium/sodium
  594::699     3e-07  31% 1203 aa  HCN4_HUMAN RecName: Full=Potassium/sodium
  463::622     3e-07  30%  910 aa  HCN1_RAT RecName: Full=Potassium/sodium hyperpolarization-activated
  410::569     3e-07  30%  822 aa  HCN1_RABIT RecName: Full=Potassium/sodium
  463::622     3e-07  30%  910 aa  HCN1_MOUSE RecName: Full=Potassium/sodium
  474::633     3e-07  30%  890 aa  HCN1_HUMAN RecName: Full=Potassium/sodium
   64::142     4e-07  38% 1011 aa  RPGF4_MOUSE RecName: Full=Rap guanine nucleotide exchange factor
  850::922     4e-07  23% 1512 aa  NTE1_PHANO RecName: Full=Lysophospholipase NTE1;       
  483::568     4e-07  26%  934 aa  KGP25_DROME RecName: Full=cGMP-dependent protein kinase, isozyme 2
  637::722     4e-07  26% 1088 aa  KGP24_DROME RecName: Full=cGMP-dependent protein kinase, isozyme 2
  235::322     4e-07  30%  686 aa  KGP1B_HUMAN RecName: Full=cGMP-dependent protein kinase 1, beta
  220::307     4e-07  30%  671 aa  KGP1A_HUMAN RecName: Full=cGMP-dependent protein kinase 1, alpha
  345::422     4e-07  27%  525 aa  KAPR_USTMA RecName: Full=cAMP-dependent protein kinase regulatory
  385::459     4e-07  31%  820 aa  GORK_ARATH RecName: Full=Potassium channel GORK;AltName: Full=Guard
   58::225     4e-07  25%  248 aa  FIXK_AZOC5 RecName: Full=Nitrogen fixation regulation protein fixK;
  618::692     5e-07  29% 1352 aa  PLPL7_MOUSE RecName: Full=Patatin-like phospholipase
  860::932     5e-07  27% 1522 aa  NTE1_ASPFU RecName: Full=Lysophospholipase nte1;       
  185::274     5e-07  34%  427 aa  KAPR_RHIRA RecName: Full=cAMP-dependent protein kinase regulatory
  516::621     5e-07  30%  863 aa  HCN2_RAT RecName: Full=Potassium/sodium hyperpolarization-activated
  516::621     5e-07  30%  863 aa  HCN2_MOUSE RecName: Full=Potassium/sodium
  543::648     5e-07  30%  889 aa  HCN2_HUMAN RecName: Full=Potassium/sodium
  626::699     6e-07  28% 1425 aa  SWS_DROME RecName: Full=Protein Swiss cheese;
  130::221     6e-07  37%  390 aa  KAPR_MAGGR RecName: Full=cAMP-dependent protein kinase regulatory
  133::229     6e-07  30%  401 aa  KAP2_MOUSE RecName: Full=cAMP-dependent protein kinase type
  136::232     6e-07  30%  404 aa  KAP2_HUMAN RecName: Full=cAMP-dependent protein kinase type
  129::226     8e-07  34%  389 aa  KAPR_BLUGR RecName: Full=cAMP-dependent protein kinase regulatory
  133::229     8e-07  30%  401 aa  KAP2_BOVIN RecName: Full=cAMP-dependent protein kinase type
   52::243     8e-07  19%  250 aa  FNR_SHIFL RecName: Full=Fumarate and nitrate reduction regulatory
   52::243     8e-07  19%  250 aa  FNR_KLEOX RecName: Full=Fumarate nitrate reduction regulatory
   52::243     8e-07  19%  250 aa  FNR_ECOLI RecName: Full=Fumarate and nitrate reduction regulatory
   52::243     8e-07  19%  250 aa  FNR_ECOL6 RecName: Full=Fumarate and nitrate reduction regulatory
   52::243     8e-07  19%  250 aa  FNR_ECO57 RecName: Full=Fumarate and nitrate reduction regulatory
   64::142     1e-06  36% 1011 aa  RPGF4_HUMAN RecName: Full=Rap guanine nucleotide exchange factor
  596::670     1e-06  28% 1317 aa  PLPL7_HUMAN RecName: Full=Patatin-like phospholipase
  567::672     1e-06  29% 1174 aa  KCNAE_DROME RecName: Full=Potassium voltage-gated channel protein
  426::531     1e-06  32%  780 aa  HCN3_RAT RecName: Full=Potassium/sodium hyperpolarization-activated
  426::531     1e-06  32%  779 aa  HCN3_MOUSE RecName: Full=Potassium/sodium
  427::532     1e-06  32%  774 aa  HCN3_HUMAN RecName: Full=Potassium/sodium
   52::243     1e-06  19%  250 aa  FNR_SHIDY RecName: Full=Fumarate and nitrate reduction regulatory
   52::243     1e-06  19%  250 aa  FNR_SALTY RecName: Full=Fumarate and nitrate reduction regulatory
   52::243     1e-06  19%  250 aa  FNR_SALTI RecName: Full=Fumarate and nitrate reduction regulatory
   52::243     1e-06  19%  250 aa  FNR_SALMS RecName: Full=Fumarate and nitrate reduction regulatory
   37::239     1e-06  22%  257 aa  FNR_HAEIN RecName: Full=Anaerobic regulatory protein;
  220::307     1e-06  30%  671 aa  KGP1A_RABIT RecName: Full=cGMP-dependent protein kinase 1, alpha
  275::361     1e-06  26%  412 aa  KAPR_SCHPO RecName: Full=cAMP-dependent protein kinase regulatory
  963::1039    2e-06  31% 1621 aa  NTE1_CRYNE RecName: Full=Lysophospholipase NTE1;       
   55::242     2e-06  19%  257 aa  FNR_ACTAC RecName: Full=Anaerobic regulatory protein;
   52::235     2e-06  21%  250 aa  ETRA_SHEON RecName: Full=Electron transport regulator A;
  286::403     3e-06  26%  762 aa  KGP2_HUMAN RecName: Full=cGMP-dependent protein kinase 2;       
  546::651     3e-06  29%  988 aa  KCNH5_MOUSE RecName: Full=Potassium voltage-gated channel subfamily
  129::222     3e-06  36%  385 aa  KAPR_NEUCR RecName: Full=cAMP-dependent protein kinase regulatory
   53::255     3e-06  18%  273 aa  FNR_PASMU RecName: Full=Anaerobic regulatory protein;
  593::698     4e-06  33%  994 aa  KCNH6_HUMAN RecName: Full=Potassium voltage-gated channel subfamily
  546::651     4e-06  29%  988 aa  KCNH5_RAT RecName: Full=Potassium voltage-gated channel subfamily H
  335::428     5e-06  27%  459 aa  KAPR_CANAL RecName: Full=cAMP-dependent protein kinase regulatory
   33::238     5e-06  18%  240 aa  HLYX_ACTPL RecName: Full=Regulatory protein hlyX;
  627::701     7e-06  40%  867 aa  PDE5_DICDI RecName: Full=cGMP-dependent 3',5'-cGMP
  286::403     7e-06  25%  762 aa  KGP2_RAT RecName: Full=cGMP-dependent protein kinase 2;       
  286::403     7e-06  25%  762 aa  KGP2_MOUSE RecName: Full=cGMP-dependent protein kinase 2;       
  743::844     9e-06  34% 1427 aa  NTE1_YARLI RecName: Full=Lysophospholipase NTE1;       
  546::651     9e-06  28%  988 aa  KCNH5_HUMAN RecName: Full=Potassium voltage-gated channel subfamily
  721::795     1e-05  34% 1386 aa  NTE1_CANAL RecName: Full=Lysophospholipase NTE1;       
  181::270     1e-05  31%  768 aa  KGP1_DROME RecName: Full=cGMP-dependent protein kinase, isozyme 1; 
  950::1050    1e-05  29% 1096 aa  PDE6_DICDI RecName: Full=cAMP/cGMP-dependent 3',5'-cAMP/cGMP
  145::236     1e-05  37%  404 aa  KAPR_COLTR RecName: Full=cAMP-dependent protein kinase regulatory
  264::325     3e-05  34%  926 aa  RPGF3_RAT RecName: Full=Rap guanine nucleotide exchange factor
  264::331     3e-05  32%  923 aa  RPGF3_HUMAN RecName: Full=Rap guanine nucleotide exchange factor
 1186::1259    3e-05  28% 1883 aa  NTE1_USTMA RecName: Full=Lysophospholipase NTE1;       
  593::698     3e-05  30%  950 aa  KCNH6_RAT RecName: Full=Potassium voltage-gated channel subfamily H
   52::243     3e-05  20%  250 aa  FNR_YERPE RecName: Full=Fumarate and nitrate reduction regulatory
  264::325     3e-05  34%  918 aa  RPGF3_MOUSE RecName: Full=Rap guanine nucleotide exchange factor
  448::558     3e-05  30%  706 aa  CNG18_ARATH RecName: Full=Putative cyclic nucleotide-gated ion
   52::235     4e-05  20%  250 aa  FNR_VIBCH RecName: Full=Fumarate and nitrate reduction regulatory
   52::235     4e-05  20%  250 aa  FNR_VIBC3 RecName: Full=Fumarate and nitrate reduction regulatory
  590::657     6e-05  29% 1234 aa  YNX5_CAEEL RecName: Full=Uncharacterized protein T20G5.5;
   54::224     6e-05  15%  237 aa  YCF28_PORYE RecName: Full=Putative HTH-type transcriptional
  525::611     6e-05  31%  706 aa  CNGA3_BOVIN RecName: Full=Cyclic nucleotide-gated cation channel
  470::580     6e-05  31%  678 aa  CNG15_ARATH RecName: Full=Putative cyclic nucleotide-gated ion
  491::594     7e-05  29% 1094 aa  P2C19_ARATH RecName: Full=Protein phosphatase 2C and cyclic
  745::848     7e-05  29% 1161 aa  KCNH2_RABIT RecName: Full=Potassium voltage-gated channel subfamily
   28::238     7e-05  21%  248 aa  FNRL_RHOS4 RecName: Full=Transcriptional activator protein fnrL;
  372::458     7e-05  33%  575 aa  CNGA4_HUMAN RecName: Full=Cyclic nucleotide-gated cation channel
  584::649     1e-04  33% 1087 aa  KCNH3_RAT RecName: Full=Potassium voltage-gated channel subfamily H
  584::649     1e-04  33% 1087 aa  KCNH3_MOUSE RecName: Full=Potassium voltage-gated channel subfamily
  581::646     1e-04  33% 1083 aa  KCNH3_HUMAN RecName: Full=Potassium voltage-gated channel subfamily
  453::539     1e-04  32%  665 aa  CNG_DROME RecName: Full=Cyclic nucleotide-gated cation channel;    
  480::552     1e-04  31%  726 aa  CNG14_ARATH RecName: Full=Probable cyclic nucleotide-gated ion
  601::675     1e-04  31% 1353 aa  YOL4_CAEEL RecName: Full=Uncharacterized NTE family protein
 1004::1095    1e-04  30% 1728 aa  NTE1_CANGA RecName: Full=Lysophospholipase NTE1;       
  768::848     1e-04  34% 1163 aa  KCNH2_RAT RecName: Full=Potassium voltage-gated channel subfamily H
  768::848     1e-04  34% 1162 aa  KCNH2_MOUSE RecName: Full=Potassium voltage-gated channel subfamily
  766::846     1e-04  34% 1159 aa  KCNH2_HUMAN RecName: Full=Potassium voltage-gated channel subfamily
  765::845     1e-04  34% 1158 aa  KCNH2_CANFA RecName: Full=Potassium voltage-gated channel subfamily
   49::205     1e-04  25%  237 aa  FIXK_BRAJA RecName: Full=Nitrogen fixation regulation protein fixK;
  372::458     1e-04  31%  575 aa  CNGA4_RAT RecName: Full=Cyclic nucleotide-gated cation channel
  372::458     1e-04  31%  575 aa  CNGA4_MOUSE RecName: Full=Cyclic nucleotide-gated cation channel
  841::915     2e-04  36%  958 aa  YA7B_SCHPO RecName: Full=Uncharacterized protein C24H6.11c;
  769::849     2e-04  33% 1195 aa  KCNH7_RAT RecName: Full=Potassium voltage-gated channel subfamily H
  769::849     2e-04  33% 1195 aa  KCNH7_MOUSE RecName: Full=Potassium voltage-gated channel subfamily
  769::849     2e-04  33% 1196 aa  KCNH7_HUMAN RecName: Full=Potassium voltage-gated channel subfamily
  553::620     2e-04  28%  962 aa  KCNH1_RAT RecName: Full=Potassium voltage-gated channel subfamily H
  580::647     2e-04  28%  989 aa  KCNH1_MOUSE RecName: Full=Potassium voltage-gated channel subfamily
  580::647     2e-04  28%  989 aa  KCNH1_HUMAN RecName: Full=Potassium voltage-gated channel subfamily
  580::647     2e-04  28%  987 aa  KCNH1_BOVIN RecName: Full=Potassium voltage-gated channel subfamily
  506::592     2e-04  30%  694 aa  CNGA3_HUMAN RecName: Full=Cyclic nucleotide-gated cation channel
  455::541     2e-04  30%  645 aa  CNG3_CHICK RecName: Full=Cyclic nucleotide-gated channel rod
  480::552     2e-04  31%  720 aa  CNG17_ARATH RecName: Full=Probable cyclic nucleotide-gated ion
  661::737     3e-04  30% 1316 aa  NTE1_SCHPO RecName: Full=Lysophospholipase NTE1;       
  734::810     3e-04  27% 1441 aa  NTE1_KLULA RecName: Full=Lysophospholipase NTE1;       
  447::533     3e-04  30%  631 aa  CNGA3_MOUSE RecName: Full=Cyclic nucleotide-gated cation channel
  494::580     3e-04  30%  683 aa  CNGA1_RAT RecName: Full=cGMP-gated cation channel alpha-1;AltName:
  495::581     3e-04  30%  684 aa  CNGA1_MOUSE RecName: Full=cGMP-gated cation channel
  503::589     3e-04  30%  690 aa  CNGA1_HUMAN RecName: Full=cGMP-gated cation channel
  502::588     3e-04  30%  691 aa  CNGA1_CANFA RecName: Full=cGMP-gated cation channel
  501::587     3e-04  30%  690 aa  CNGA1_BOVIN RecName: Full=cGMP-gated cation channel
  548::634     3e-04  30%  735 aa  CNG1_CHICK RecName: Full=Cyclic nucleotide-gated channel cone
  212::309     4e-04  29%  673 aa  CT152_MOUSE RecName: Full=Uncharacterized protein C20orf152
  480::560     4e-04  28%  664 aa  CNGA2_MOUSE RecName: Full=Cyclic nucleotide-gated olfactory
   54::233     5e-04  15%  237 aa  YCF28_PORPU RecName: Full=Putative HTH-type transcriptional
  516::608     5e-04  26%  694 aa  CNGB3_MOUSE RecName: Full=Cyclic nucleotide-gated cation channel
  480::560     5e-04  28%  664 aa  CNGA2_RAT RecName: Full=Cyclic nucleotide-gated olfactory
  478::558     5e-04  28%  664 aa  CNGA2_RABIT RecName: Full=Cyclic nucleotide-gated olfactory
  478::558     5e-04  28%  664 aa  CNGA2_HUMAN RecName: Full=Cyclic nucleotide-gated olfactory
  478::558     5e-04  28%  663 aa  CNGA2_BOVIN RecName: Full=Cyclic nucleotide-gated olfactory
  394::497     5e-04  22%  802 aa  AKT2_ARATH RecName: Full=Potassium channel AKT2/3;
   30::236     6e-04  20%  240 aa  FNRN_RHILV RecName: Full=Probable transcriptional
  497::607     6e-04  29%  717 aa  CNGC5_ARATH RecName: Full=Probable cyclic nucleotide-gated ion
    1::221

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDNDAPLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAIMG
CRP_HAEIN       ---------------------------------LIHAGEDATTLYYVIKGSVMVSSKDDEGKEMILTYLG
CRP_SHIFL       ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
CRP_SALTY       ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
CRP_KLEAE       ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
CRP_ECOLI       ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
CRP_ECOL6       ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
CRP_ECO57       ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
CRP_PASMU       ---------------------------------LIHAGEKAETLYYLIKGSVAVLVKDEDGKEMILTYLS
VFR_PSEAE       ---------------------------------IIYAGDRCETLFFIIKGSVTILIEDDDGREMIIGYLN
FNR_BACSU       ------------------LESISTKRKMEKHTYLFREGMDAEELYLIQSGLIEIGKLTSDGKDLTLRICQ
NTCA_SYNE7      --------------------------QFERGKTIFFPGDPAERVYLLVKGAVKLSRVYESGEEITVALLR
NTCA_SYNY3      -----------------------------RSKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLR
NTCA_ANAVT      -----------------------------RNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLR
NTCA_ANASP      -----------------------------RNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLR
FLP_LACCA       -----PLFKNLNDEARAAIDALTHERQVEKGTVLISP-DTAAHLLVVAHGKLKTYQLATNGKEQLLRVDG
CLP_XANCP       ---------------------------------VFRPGDPAGTLYYVISGSVSIIAEEDDDRELVLGYFG
Y2593_MYCBO     ---------------------------VKAGEVLFEQSTMGDLIYVVSEGEFEIVRELADGGEELVKTAA
Y2564_MYCTU     ---------------------------VKAGEVLFEQSTMGDLIYVVSEGEFEIVRELADGGEELVKTAA
KAPR_KLULA      ------LFNKLDSDSKKLVINSLEEKSIPQGKEIIKQGDEGDYFYIVEDGTVEFYVNNQK-----VNTSG
NTE1_CHAGB      --------------------------QVNAGQVIFHEGDESEAIYIVLNGRLRLVEDRKDGGMNVKAEYG
KAPR_YARLI      ------LFGNLDEEACRSVLQSLQEKKCDSGEKIITQGDEGDYFYIVESGAVEF---IKDGVK--VNSSG
KAPR_ASHGO      ------LFNKLDSDSKTLVINSLEEKLVSKGQEIIRQGDEGDYFYIVEKGTVDF---FLDDRK--VNTYG
NTE1_ASPTN      --------------------------QVNAGQVIYHQGDESDAIYLVLNGRLRSVLEGTDGKMNVVGEYG
KAPR_DICDI      ------MFSHLEEEERNVVFLAMVEVLYKAGDIIIKQGDEGDLFYVIDSGICDIYVCQNGGSPTLVMEVF
KAPR_YEAST      ------LFNKLDSDSKRLVINCLEEKSVPKGATIIKQGDQGDYFYVVEKGTVDFYVN-----DNKVNSSG
KAPR_BLAEM      ------LFRNLDEDQYTDVVNAMAEKKVAAGEVVIRQGGVGDYFYVVETGALDVFVNRNGNGDVKVTDYS
KAPR_APLCA      ------LFSHLDDNERSDIFDAMFPVHRHAGEVIIQQGDEGDNFYVIDQGEVDVYVNNVH-----VTSIG
NTE1_NEUCR      --------------------------QVNSGQVLFREGDESEAIYLVLNGRLRLVEDQKDGGMNVKAEFG
KAPR_TRIAT      ---EVPILSSLTPYERSKISDALETQKFAPGDVIIHEGDPGHSFYLLESGEA----AAFKGEEQVLSYK-
CNGK1_RHILO     -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNP-------VELG
NTE1_ASPOR      ------------------------------GQVIYHQGDESDAIYLVLNGRLRSVLEGTDGKITVVGEYG
NTE1_ASPCL      --------------------------QVNAGQVIYHQGDESDAIYLVLNGRLRSVLESADNKLTVIGEYG
KAPR_CANGA      ------LFNKLDSDSKKLVINCLEEKRVSKGTEIIKQGDEGDYFYVVETGTVEFFVNNEK-----VNTSG
NTE1_COCIM      --------------------------QVNAGQVIHHQGDESDAIYIVLNGRLRAVLDKGDGKVSVLGEYG
KAPR_ASPNG      ------LFSHLDDDQFKSVLDALVEKPIAKGIKVISQGDAGDYFYIVENGHFDFMQPGPDGMGNKVGSVG
KAPR2_DROME     --NSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSV-RMDQDDAEVEISQLG
CNGK1_RHIEC     -----PLFQKLGSAALIEIVRALRPRIVPAGAVICRKGEVGDQMFFIVEGRVTVATPDHPVE------LG
KAP3_RAT        ---DILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDI-YVKCDGVGRCVGNYD
KAP3_MOUSE      ---DILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDI-YVKCDGVGRCVGNYD
KAP3_BOVIN      ---DILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDI-YVKCDGVGRCVGNYD
KAPR_EMENI      ---EVPLLSSLKPYERAKIADALDTIKFPAGEYIIKEGDPGDAFYLLESGEAE---AFMEGVEEPVKSYK
FNRA_PSEST      ---------------------------LKKGETLFRQGDTFSSVFAVRSGALRTFSVTDGGEEQITGFHL
Y4233_RHOPA     -----PLFSHLTAGDIAHIMQLLQARQIERGEVVFRRGEPATAMYFIAEGDVEIELGPEDKGRRIR--LG
NTE1_EMENI      --------------------------QVNAGQVIYHQGDESDAIYITLNGRLRSVHEGKGGKMTVVGEHG
KAPR_STRPU      ------LFRALDEKQMQEVIDAMFEKKTTPGDHVIDQGDDGDNFYVIDRGEYDI-----FVNDNKVGAYK
KAP3_HUMAN      ---DILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDI-YVKCDGVGRCVGNYD
NTE1_ASPNC      ------------------------------GQVIYHQGDESDAIYLALNGRLRSVHEGPNGKMTVVGEYG
KAP0_PONAB      ------LFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQGE-----TDVYVNNEWATSVG
KAP0_HUMAN      ------LFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQGE-----TDVYVNNEWATSVG
KAPR_ASPFU      ------LFSHLDDDQFRTVLDALVEKPIPAKDIVISQGDAGDYFYIVENGHFDVYQPGPDGIGNKVSTIG
AADR_RHOPA      -------------------------------EALFSEDEVADSVYSLIEGIARLYKLLPDGRRQIIGFAL
KAPR1_DROME     ------LFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVFVNSE-----LVTTIS
KAP0_RAT        ------LFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNN-----EWATSVG
KAP0_MOUSE      ------LFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNN-----EWATSVG
KAP0_BOVIN      ------LFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNN-----EWATSVG
FIXK_RHIME      ------------------------------GREIYAQGDLNDKCYQVSTGAVRIYRLLSDGRRQVVSFHL
NTE1_NEOFI      --------------------------QVNAGQVIYHQGDESDAIYLVLNGRLRSVLESPGNKLAVIGEYG
NTE1_MAGGR      --------------------------QVNAGEVIFHGGEESEAIYIVLNGRLRLVEDRQEGGVDVRGEFG
KAP0_PIG        ------LFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNN-----EWATSVG
Y2594_MYCBO     ---NVPILADIDDEQLERLATTVERRHVPANQWLFHAGEPADSIYIVDSG--RFVAVAPEG--HVFAEMA
Y2565_MYCTU     ---NVPILADIDDEQLERLATTVERRHVPANQWLFHAGEPADSIYIVDSG--RFVAVAPEG--HVFAEMA
SKOR_ARATH      -----PLFRGCSSEFINQIVIRLHEEFFLPGEVIMEQGSVVDQLYFVCHGVLEEIGITKDGSEEIVAVLQ
KGP1B_MOUSE     -----PTFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTREDSPSEDPVLRTLG
KGP1B_BOVIN     -----PTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGKVNVTREDSPNEDPVLRTLG
KGP1A_MOUSE     -----PTFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTREDSPSEDPVLRTLG
KGP1A_BOVIN     -----PTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGKVNVTREDSPNEDPVLRTLG
KAPR_GLOLA      ---EVPLLQTLTPYERSKIADALETQKYTPGATIIKEGDPGHSFYLLESGEADA--YLGDGKESVKHY-S
KAPR_DEBHA      ------LFRQLDVSSKKTVIEALGKKEFKNGDEIIKQGDEGDYFYIIEKGTVDFYVNG-----NQVNSSG
KAP0_CHICK      ------LFAHLDDNERSDIFDAMFPVTYIAGETVIQQGDEGDNFYVVDQGEMDVYVNN-----EWATSVG
KAPR_CAEEL      ------LFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDV----YVNHEYVLTI-N
BTR_BORPE       --------------------------RVERGKTLYELDDPLDAVYGVRFGSLKTQLEDSSGQLQITGFHL
KAP2_RAT        ---DILLFKNLDQEQLSQVLDAMFEKIVKTDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDN
ANR_PSEAE       ---------------------------LKKGEFLFRQGDPFGSVFAVRSGALKTFSITDAGEEQITGFHL
PLPL7_RAT       --------------------------EVEAGRAIYRQGDKSDCTYIVLSGRLRSVIRKDDGKKRLAGEYG
KAP1_RAT        ------LFSHLDDNERSDIFDAMFPVTHIDGETVIQQGNEGDNFYVIDQGEVDV-YVNGEWVTNI----S
KAP1_MOUSE      ------LFSHLDDNERSDIFDAMFPVTHIGGETVIQQGNEGDNFYVIDQGEVDV-YVNGEWVTNI----S
PLPL6_PONAB     ------------------------------GRALYRQGDRSDCTYIVLNGRLRSVIQRGSGKKELVGEYG
PLPL6_MOUSE     ------------------------------GRALYRQGDRSDCTYIVLNGRLRSVIQRGSGKKELVGEYG
PLPL6_HUMAN     ------------------------------GRALYRQGDRSDCTYIVLNGRLRSVIQRGSGKKELVGEYG
KAP1_HUMAN      ------LFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQGEVDV-YVNGEWVTNI----S
HCN4_RAT        -----PLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSV--LTKGNKETKLA---
HCN4_RABIT      -----PLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSV--LTKGNKETKLA---
HCN4_MOUSE      -----PLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSV--LTKGNKETRLA---
HCN4_HUMAN      -----PLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSV--LTKGNKETKLA---
HCN1_RAT        -----PLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVA--GVITKSSKEMKLT---
HCN1_RABIT      -----PLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVA--GVITKSSKEMKLT---
HCN1_MOUSE      -----PLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVA--GVITKSSKEMKLT---
HCN1_HUMAN      -----PLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVA--GVITKSSKEMKLT---
RPGF4_MOUSE     ---------------------------LEKGITLFRQGDIGTNWYAVLAGSVKVSETSSHQDAVTICTLG
NTE1_PHANO      --------------------------QVNAGQVIYNQGEESDAIYIVLNGRLRAIKDAENGKVTVIGEYG
KGP25_DROME     -----PIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEKFIRMLG
KGP24_DROME     -----PIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEKFIRMLG
KGP1B_HUMAN     -----PTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVLRTLG
KGP1A_HUMAN     -----PTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVLRTLG
KAPR_USTMA      ---DVPLFERLSAAERAKISDSLELREYSRGEAVISQGERGSEFFIIVEGDAEVRKTKQGG-EEVVGKLS
GORK_ARATH      -----PLFKGCSTEFINQIVIRLHEEYFLPGEVITEQGNVVDHLYFVCEGLLEALVTKTDGSEESVTLLG
FIXK_AZOC5      -----------------------------RNSEIFGDDQVAENVYVVVSGVVRICKLMGDGRRQIEAFCL
PLPL7_MOUSE     --------------------------EVEAGRAIYRQGDKSDCTYIVLSGRLRSVIRKDDGKKRLAGEYG
NTE1_ASPFU      --------------------------QVNAGQVIYRQGDESDAIYLVLNGRLRSVLESPGNKLAVVGEYG
KAPR_RHIRA      ------LFRNLDEEQYLDVVNAMSEKRVVKGTTVIEQGSVGDFFYVVESGTLDIG-------QNKVTNYE
HCN2_RAT        -----PLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSV---LTKGNKEMK--LS
HCN2_MOUSE      -----PLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSV---LTKGNKEMK--LS
HCN2_HUMAN      -----PLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSV---LTKGNKEMK--LS
SWS_DROME       ---------------------------LESGRAVYRQDESSDSTYIVLSGRMRSVITHPGGKKEIVGEYG
KAPR_MAGGR      ------LFSHLDDEQSAQILGALVEKPIPAKDIVIVQGDAGDYFYVVEKGKFSVHVNSSQGLGDHVGTIE
KAP2_MOUSE      ---DILLFKNLDQEQLSQVLDAMFEKIVKTDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDN
KAP2_HUMAN      ---DILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDN
KAPR_BLUGR      ------LFNHLDDEQSAQVLGALVEKPIPVKDIVISQGDQGDFFYVVEKGSFDVYQPGLGGLGNKVATIE
KAP2_BOVIN      ---DILLFKNLDPEQLSQVLDAMFERTVKVDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDN
FNR_SHIFL       ---------------------------IQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHL
FNR_KLEOX       ---------------------------IQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHL
FNR_ECOLI       ---------------------------IQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHL
FNR_ECOL6       ---------------------------IQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHL
FNR_ECO57       ---------------------------IQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHL
RPGF4_HUMAN     ---------------------------LEKGITLFRQGDIGTNWYAVLAGSVKVSETSSHQDAVTICTLG
PLPL7_HUMAN     --------------------------EVEAGRAIYRQGDKSDCTYIMLSGRLRSVIRKDDGKKRLAGEYG
KCNAE_DROME     --NEHPAFRLASDGCLRALAMHFMMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQD-----DEVVAILG
HCN3_RAT        -----PLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSLARGARDTR------LT
HCN3_MOUSE      -----PLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSLARGARDTR------LT
HCN3_HUMAN      -----PLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSLARGARDTR------LT
FNR_SHIDY       ---------------------------IQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHL
FNR_SALTY       ---------------------------IQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHL
FNR_SALTI       ---------------------------IQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHL
FNR_SALMS       ---------------------------IQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHL
FNR_HAEIN       ----------LNEQELDQLDNIIERKKIQKSQVLFKAGDSLNSIYAIRSGTIKSYTISESGEEQITSFHL
KGP1A_RABIT     -----PTFQSLPEEILSKLADVLEETHYENEEYSIRQGARGDTFFIISKGKVNVTREDSPSEDPILRTLG
KAPR_SCHPO      ---EVPILSSLDKYQRQKIADALQTVVYQAGSIVIRQGDIGNQFYLIEDGEAEVVKNG----KGVVVTLT
NTE1_CRYNE      ------------------IDAALDWQQLNAGQVLYEKGDKSTDFYIVINGRLR-AFTEKNDNMHVLREYG
FNR_ACTAC       ---------------------------IQKSQVLFKAGDELTSLYAIRSGTIKSYTISETGEEQITSFHL
ETRA_SHEON      ---------------------------IQKGEQIFKSGDPLKSLFAIRSGTIKSYTITEQGDEQITGFHL
KGP2_HUMAN      ------LLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQTEGHDQPQLIKTLQ
KCNH5_MOUSE     --NEHPAFQLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQD-----EEVVAILG
KAPR_NEUCR      ------LFNHLDDQSAQVLGALVEKPVPAKGIKVITQGDAGDYFYVVEKGRFEVYVNSTDGMGQKVGEIA
FNR_PASMU       ----------LNEQELDQLDNIIERKKIQKSQVLFKAGDPLNSLYAIRSGTIKTYTISETGEEQITSFQL
KCNH6_HUMAN     -----PAFSGAGKGCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRD-----DVVVAILG
KCNH5_RAT       --NEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQD-----EEVVAILG
KAPR_CANAL      ---DIEVLKSLSDHARSKLADALSTEMYHKGDKIVTEGEQGENFYLIESGNCQVYNEKLGNIKQLT----
HLYX_ACTPL      ----------LSEHELTQLDNIIERKKVQKSQIIFQSGDELRSIYAIRSGTIKSYTISESGEEQITAFHL
PDE5_DICDI      --------------------------KYSQGSVIIARDTEPDAFYVVASGVVCVN--IGELKKNLIV---
KGP2_RAT        ------LLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQTEGHDQPQLIKTLQ
KGP2_MOUSE      ------LLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQTEGHDQPQLIKTLQ
NTE1_YARLI      ------------------LDFAMEWVQVRAGQKIYKEGQEADAIYIVLNGRVRVGGESGDARKNLTSIYG
KCNH5_HUMAN     --NEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQD-----DEVVAILG
NTE1_CANAL      ------------------------------GEVLCSQGDLANGFHVVLSGRFRVVRSTNKNTEEVLGEYG
KGP1_DROME      MDND--FLKNIDASQVRELVDSMYSKSIAAGEFVIREGEVGAHLYVSAAGEFAVMQ-----QGKVLDKMG
PDE6_DICDI      ----------INKEEVDSIANGSKDVSFAHHQVIFNEGDTSDSMYIIKQGRV---RIHSKKNKNIIRYLN
KAPR_COLTR      ------LFSHLDDEQSAQILGALIEKPIPAKDIVISQGDAGEYFYVVEKGSVNEKGTLQPGPEGMGEKVG
RPGF3_RAT       ------------------------EPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTRG----KGLVTTLH
RPGF3_HUMAN     ------------------------EPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHG----KGLVTTLH
NTE1_USTMA      --------------------------QVNAGQVIYREDDPSDSFFIVINGRLRAITEKTNGIE-VHNEYG
KCNH6_RAT       -----PAFRGASKGCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRD-----DVVVAILG
FNR_YERPE       ---------------------------IQKGQALFKAGDELKSLYAIRSGTIKSYTITEEGDEQITGF--
RPGF3_MOUSE     ------------------------EPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHG----KGLVTTLH
CNG18_ARATH     -----PFFSQMDDQLLDAICGCLVSSLSTAGTYIFREGDPVNEMLFVIRGQIE-SSTTNGGRSGFFTTLR
FNR_VIBCH       ---------------------------IQKGQELFKAGDELRSLYAIRSGTIKSYTITEQGDEQITAF--
FNR_VIBC3       ---------------------------IQKGQELFKAGDELRSLYAIRSGTIKSYTITEQGDEQITAF--
YNX5_CAEEL      ------------------------EQYVHAGSVVFRQGEIGVYWYIVLKGAVEVNVNGK-----IVCLLR
YCF28_PORYE     --------------------------------------NSSSRLYIILIGSLIITKVLRNTHKVTLNLLT
CNGA3_BOVIN     ------------------------------GDYICKKGDIGREMYIIKEG--KLAVVAEDGITQFV-VLG
CNG15_ARATH     -----PLFDQMDERMLDAICERLKPALCTEGTFLVREGDPVNEMLFIIRGHLD-SYTTNGGRTGFFCLIG
P2C19_ARATH     ------LFRKLTDSQCQVLLDCMQRLEANPGDIVVKQGGEGDCFYVVGSGEFEVLATQDGKNGEVPRILE
KCNH2_RABIT     -------FRGATKDCLRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILR-----GDVVVAILG
FNRL_RHOS4      -----------DSEELATLEQIKYYRSYQAGQTVIWSGDKMDFVASVVTGIATLTQTMEDGRRQMVGLLL
CNGA4_HUMAN     ------------------------------GEYVCRKGDIGQEMYIIREG--QLAVVADDGITQ-YAVLG
KCNH3_RAT       -----PLFEAASRGCLRALSLALRPAFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGT-----VLAILG
KCNH3_MOUSE     -----PLFEAASRGCLRALSLALRPAFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGT-----VLAILG
KCNH3_HUMAN     -----PLFEAASRGCLRALSLALRPAFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGT-----VLAILG
CNG_DROME       ------------------------------GDYICRKGDVGKEMYIVKRGKLSV---VGDDGITVLATLG
CNG14_ARATH     -----PLFAQMDDQLLDAICERLASSLSTQGNYIVREGDPVTEMLFIIRGKLE-SSTTNGGRTGFFITLR
YOL4_CAEEL      ------------------------------GHACYRAGDMADSLFVVLSGRLR-----SVEKKTVVEEFG
NTE1_CANGA      ---------------------------LNASDTLFNQGDPANGIYVILNGRLRQLRNPNDGEEKVMGELG
KCNH2_RAT       ------------------------------GDTLVHAGDLLTALYFISRGSIEILR-----GDVVVAILG
KCNH2_MOUSE     ------------------------------GDTLVHAGDLLTALYFISRGSIEILR-----GDVVVAILG
KCNH2_HUMAN     ------------------------------GDTLVHAGDLLTALYFISRGSIEILR-----GDVVVAILG
KCNH2_CANFA     ------------------------------GDTLVHAGDLLTALYFISRGSIEILR-----GDVVVAILG
FIXK_BRAJA      ------------------------------GETVFSEEDITTSFYNVLEGVMRLYKLLPDGRRQIVGFAL
CNGA4_RAT       ------------------------------GEYVCRKGDIGREMYIIREGQLAV---VADDGVTQYAVLG
CNGA4_MOUSE     ------------------------------GEYVCRKGDIGREMYIIREGQLAV---VADDGVTQYAVLG
YA7B_SCHPO      ---------------------------LRKGDLLWRKGDTPSKLVILETGMVKASYQMD--RESLSENIT
KCNH7_RAT       ------------------------------GDTLVHCGDVLTALYFLSRGSIEILKD-----DIVVAILG
KCNH7_MOUSE     ------------------------------GDTLVHCGDVLTALYFLSRGSIEILKD-----DIVVAILG
KCNH7_HUMAN     ------------------------------GDTLVHCGDVLTALYFLSRGSIEILKD-----DIVVAILG
KCNH1_RAT       -----PAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLEVIQD-----DEVVAILG
KCNH1_MOUSE     -----PAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLEVIQD-----DEVVAILG
KCNH1_HUMAN     -----PAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLEVIQD-----DEVVAILG
KCNH1_BOVIN     -----PAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLEVIQD-----DEVVAILG
CNGA3_HUMAN     ------------------------------GDYICKKGDIGKEMYIINEG--KLAVVADDGVTQFV-VLS
CNG3_CHICK      ------------------------------GDYICRKGDIGREMYIIKEG--KLAVVADDGVTQFV-VLS
CNG17_ARATH     -----PFFSQMDDQLLDAICERLVSSLCTEGTYLVREGDLISEMLFIIRGRLE-SSTTNGGRTGFFIILR
NTE1_SCHPO      ---------------------------LNPDQVVYEKNDPSDCVYVVLNGRLRSERGSARTQVDYFNEYG
NTE1_KLULA      --------------------------QLDSSETLFNQGDPANGVYLVLNGRLRFYEDADSDIVTQMAELS
CNGA3_MOUSE     ------------------------------GDYICKKGDIGREMYIIKEG--KLAVVADDGVTQFV-VLS
CNGA1_RAT       ------------------------------GDYICKKGDIGREMYIIKEG--KLAVVADDGITQFV-VLS
CNGA1_MOUSE     ------------------------------GDYICKKGDIGREMYIIKEG--KLAVVADDGITQFV-VLS
CNGA1_HUMAN     ------------------------------GDYICKKGDIGREMYIIKEG--KLAVVADDGVTQFV-VLS
CNGA1_CANFA     ------------------------------GDYICKKGDIGREMYIIKEG--KLAVVADDGITQFV-VLS
CNGA1_BOVIN     ------------------------------GDYICKKGDIGREMYIIKEG--KLAVVADDGITQFV-VLS
CNG1_CHICK      ------------------------------GDYICKKGDIGREMYIIKEG--KLAVVADDGITQFV-VLS
CT152_MOUSE     -------------ESLQLLLAKVIRERFGRRRVIVKKGQMGNSFYFIYLGTVAITE-DEDGSSAFLTLLH
CNGA2_MOUSE     ------------------------------GDYICRKGDIGKEMYIIKEGKLAV---VADDGVTQYALLS
YCF28_PORPU     --------------------------------------DVNSKLYIILAGCLIVKKVFRNRKKIILNVLT
CNGB3_MOUSE     ------LFKGCDTQMIYDLLLRLKSTIYLPGDFVCKKGEIGKEMYIIKHGEVQV-LGGPDGAQVLVTLKA
CNGA2_RAT       ------------------------------GDYICRKGDIGKEMYIIKEGKLAV---VADDGVTQYALLS
CNGA2_RABIT     ------------------------------GDYICRKGDIGKEMYIIKEGKLAV---VADDGVTQYALLS
CNGA2_HUMAN     ------------------------------GDYICRKGDIGKEMYIIKEGKLAV---VADDGVTQYALLS
CNGA2_BOVIN     ------------------------------GDYICRKGDIGKEMYIIKEGKLAV---VADDGVTQYALLS
AKT2_ARATH      ------LFKGVSREILLLLVSKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEIIDSEME-RESVLGTLR
FNRN_RHILV      ---------ALSKGQLRELNRHSLRRKIEAGCEIIAQGSESSFYSNIMRGVMKLCKVMPDGRQQIVGLQF
CNGC5_ARATH     -----PLFKSMDDKLLDAICMRLKPCLFTESTYLVREGDPVDEMLFIIRGRLE-SVTTDGGRSGFFSLLK


                         .         .         *         .         .         .         .:140
query           PGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXXXXXXXNDVVADLVF
CRP_HAEIN       AGQFFGEAGLFDEGKRSAWVKTKTTCEIAEISYKKYRQLIQANPEILMFLTAQLARRLQNTSRQVTNLAF
CRP_SHIFL       QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
CRP_SALTY       QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSSQMARRLQVTSEKVGNLAF
CRP_KLEAE       QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSSQMARRLQVTSEKVGNLAF
CRP_ECOLI       QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
CRP_ECOL6       QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
CRP_ECO57       QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
CRP_PASMU       QGDFFGEAGLFEEGQRSAWIKAKSPCEIAEISYKKFRQLIQVNPDILMHLSAQLARRLQNTSRQVSNLAF
VFR_PSEAE       SGDFFGELGLFEEQERSAWVRAKVECEVAEISYAKFRELSQQDSEILYTLGSQMADRLRKTTRKVGDLAF
FNR_BACSU       KHDIVGELTLFTEEPRMLSAKVLEDGEVLVINKNKLEKELIQNGALTFEFMKWMSTHLRKIQSKIRDLLL
NTCA_SYNE7      ENSVFGVLSLL-TGQRSDRAVAFTPVQLFSVPIEFMQKALIERPELANVMLQGLSSRILQTEMMIETLAH
NTCA_SYNY3      ENSVFGVLSLV-TGQRSDRAVAFTPVELLSAPIEQVEQALKEHPDLSLLMLQGLSSRILQTEMMIETLAH
NTCA_ANAVT      ENSVFGVLSLLNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPEXXXXXXXXXXXXXXQTEMMIETLAH
NTCA_ANASP      ENSVFGVLSLLNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPEXXXXXXXXXXXXXXQTEMMIETLAH
FLP_LACCA       VGDYEGELNIANPNVYTETLTAAT---VCTISATDFQQLLLKQPQISLQLLTENARKMQALEKQAGYLGN
CLP_XANCP       SGEFVGEMGLFESDTREVILRTRTQCELAEISYERLQQLFQDAPRILYAIGVQLSKRLLDTTRKASRLAF
Y2593_MYCBO     PGDYFGEIGVLFHLPRSATVRARSDA--------------------------------------------
Y2564_MYCTU     PGDYFGEIGVLFHLPRSATVRARSDA--------------------------------------------
KAPR_KLULA      PGSSFGELALMYNSPRAATVIASTD---------------------------------------------
NTE1_CHAGB      QGESIGELEVLTETSRSGTLHAIRDT--------------------------------------------
KAPR_YARLI      PGSSFGELALMYNAPRAATVVATQPCVLWSLDRVTFRKIL------------------------------
KAPR_ASHGO      PGSCFGELALMYNSPRAVTAVAATDCVLWAL---------------------------------------
NTE1_ASPTN      QGESVGELEVMTESTRPATLHAIRDTELA-----------------------------------------
KAPR_DICDI      EGGSFGELALIYGSPRAATVIARTD---------------------------------------------
KAPR_YEAST      PGSSFGELALMYNSPRAATVVATSDCLLWALDRLTFRKILLG----------------------------
KAPR_BLAEM      AGGSFGELALMYNAPRAATVVATAESVLWAL---------------------------------------
KAPR_APLCA      EGGSFGELALIYGTPRAATVKAKTDVKLWGIDRDSYRRILMGSTI-------------------------
NTE1_NEUCR      QGESIGELEVLTESARTGTLHAIRET--------------------------------------------
KAPR_TRIAT      KGDFFGELALLNDAPRAASVIATSDVKVATL---------------------------------------
CNGK1_RHILO     PGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEI------------------------
NTE1_ASPOR      QGESVGELEVMTESTRPATLHAIRDTELA-----------------------------------------
NTE1_ASPCL      QGESVGELEVMTESTRPATLHAIRDTELA-----------------------------------------
KAPR_CANGA      AGSSFGELALMYNSPRAATVVAQTDCTLWALDRLTFRKILLG----------------------------
NTE1_COCIM      QGDSVGELEVMTESTRPGTLHAIRDTELA-----------------------------------------
KAPR_ASPNG      PGGSFGELALMYNAPRAATVVSV-----------------------------------------------
KAPR2_DROME     KGQYFGELALVTHRPRAASVYA------------------------------------------------
CNGK1_RHIEC     AGNFFGEMALISGDPRSATVSAATEVSLLSL---------------------------------------
KAP3_RAT        NRGSFGELALMYNTPRAATITATSPGALWGL---------------------------------------
KAP3_MOUSE      NRGSFGELALMYNTPRAATITATSPGALWGL---------------------------------------
KAP3_BOVIN      NRGSFGELALMYNTPRAATITATSPGALWGL---------------------------------------
KAPR_EMENI      RGDYFGELALLDDKPRAASVRAKTEVKVAKLGRDGFKRLL------------------------------
FNRA_PSEST      PSELVG-LSGMDTEMYPVTAQALETTSVCEIPFERLDELSVLLPQLRRQLMRIMSREIRDDQQMMLLLSK
Y4233_RHOPA     TGHFFGEIAVLKRVERSATVKAVSRTRLLVLDGADLRALIAREPSI------------------------
NTE1_EMENI      QGESVGELEVMTESTRPATLHAIRDTELA-----------------------------------------
KAPR_STRPU      DSGSFGELALMYNTPRAATIAATTDGILWAL---------------------------------------
KAP3_HUMAN      NRGSFGELALMYNTPRAATITATSPGALWGL---------------------------------------
NTE1_ASPNC      QGESVGELEVMTESTRPATLHAIRDTELA-----------------------------------------
KAP0_PONAB      EGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMG----------------------------
KAP0_HUMAN      EGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMG----------------------------
KAPR_ASPFU      PGGSFGELALMYNAPRAATIVS------------------------------------------------
AADR_RHOPA      PGDFLG----MAPGNRSFSADSIGGVTVCKFFRGPFLRFIENRPQMLLRMNDFATRELSLAQDQMLLLGR
KAPR1_DROME     EGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTI-------------------------
KAP0_RAT        EGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMG----------------------------
KAP0_MOUSE      EGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMG----------------------------
KAP0_BOVIN      EGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMG----------------------------
FIXK_RHIME      PGEMFG----FEAGSHSFFAEAITETTLAIFGRRNMQERSRELLALALTGMARAQQHLLVIGRQCA----
NTE1_NEOFI      QGESVGELEVMTESTRPATLHAIRDTELA-----------------------------------------
NTE1_MAGGR      QGESIGELEVLTESARSGTLHAIRNT--------------------------------------------
KAP0_PIG        EGGSFGELALIYGTPRAATVKAKTN---------------------------------------------
Y2594_MYCBO     SGDSIGDLGVIAGAARSAGVRALRDGVVWRIAAETFTDMLEATPLL------------------------
Y2565_MYCTU     SGDSIGDLGVIAGAARSAGVRALRDGVVWRIAAETFTDMLEATPLL------------------------
SKOR_ARATH      PDHSFGEISILCNIPQPYTVRVAELCRILRLDKQSFMNILE-----------------------------
KGP1B_MOUSE     KGDWFGEKALQGEDVRTANVIA------------------------------------------------
KGP1B_BOVIN     KGDWFGEKALQGEDVRTANVIA------------------------------------------------
KGP1A_MOUSE     KGDWFGEKALQGEDVRTANVIA------------------------------------------------
KGP1A_BOVIN     KGDWFGEKALQGEDVRTANVIA------------------------------------------------
KAPR_GLOLA      KGDFFGELALLNDAPRAASIVATTDVKVASL---------------------------------------
KAPR_DEBHA      EGSSFGELALMYNSPRAATAVAASDT--------------------------------------------
KAP0_CHICK      EGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMG----------------------------
KAPR_CAEEL      EGGSFGELALIYGTPRAATVIAKTD---------------------------------------------
BTR_BORPE       PGEIVGLDGMIESKHVSSAV-ALEDSEVCVIRLPEIDRVSTQLPSLQQQFRRLMSREITRSHQMLATVGA
KAP2_RAT        RGS-FGELALMYNTPRAATIVATSDGSLWGL---------------------------------------
ANR_PSEAE       PSELVG-LSGMDTETYPVSAQALETTSVCEIPFERLDELSEXXXXXXXXXXXXXXXEIRDDQQMMLLLSK
PLPL7_RAT       RGDLVGVVEMLTHQARATTVHAVRDSELAKL---------------------------------------
KAP1_RAT        EGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMG----------------------------
KAP1_MOUSE      EGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMG----------------------------
PLPL6_PONAB     RGDLIGVVEALTRQPRATTVHAVRDTELAKL---------------------------------------
PLPL6_MOUSE     RGDLIGVVEALTRQPRATTVHAVRDTELAKL---------------------------------------
PLPL6_HUMAN     RGDLIGVVEALTRQPRATTVHAVRDTELAKL---------------------------------------
KAP1_HUMAN      EGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMG----------------------------
HCN4_RAT        DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMM------------------------
HCN4_RABIT      DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMM------------------------
HCN4_MOUSE      DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMM------------------------
HCN4_HUMAN      DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMM------------------------
HCN1_RAT        DGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRR----------------AFETVA
HCN1_RABIT      DGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRR----------------AFETVA
HCN1_MOUSE      DGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRR----------------AFETVA
HCN1_HUMAN      DGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRR----------------AFETVA
RPGF4_MOUSE     IGTAFGE-SILDNTPRHATIVTRESSELLRIEQED-----------------------------------
NTE1_PHANO      QGDSVGELEVLTETARPGSLHAIRDTELA-----------------------------------------
KGP25_DROME     KGDFFGEKALQGDDLRTANI--------------------------------------------------
KGP24_DROME     KGDFFGEKALQGDDLRTANI--------------------------------------------------
KGP1B_HUMAN     KGDWFGEKALQGEDVRTANVIA------------------------------------------------
KGP1A_HUMAN     KGDWFGEKALQGEDVRTANVIA------------------------------------------------
KAPR_USTMA      RGDYFGELALLN----------------------------------------------------------
GORK_ARATH      PHTSFGDISI------------------------------------------------------------
FIXK_AZOC5      PGDAFG----WETGERRFSAEAVSECRLVRVKRSVLFARAGSDPELACALWALSFAELQRAQEHLLLLGR
PLPL7_MOUSE     RGDLVGVVETLTHQARATTVHAVRDSELAKL---------------------------------------
NTE1_ASPFU      QGESVGELEVMTESTRPATLHAIRDTELA-----------------------------------------
KAPR_RHIRA      AGGSFGELALMYNAPRAATIITTSDSVLWAL---------------------------------------
HCN2_RAT        DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMM------------------------
HCN2_MOUSE      DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMM------------------------
HCN2_HUMAN      DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMM------------------------
SWS_DROME       KGDLVGIVEMITETSRTTTVMAVRDSELAKL---------------------------------------
KAPR_MAGGR      AGGSFGELALMYNAPRAATV--------------------------------------------------
KAP2_MOUSE      RGS-FGELALMYNTPRAATIIATSEGSLWGL---------------------------------------
KAP2_HUMAN      RGS-FGELALMYNTPRAATIVATSEGSLWGL---------------------------------------
KAPR_BLUGR      PGGSFGELALMYNAPRAATVISAEGS--------------------------------------------
KAP2_BOVIN      HGS-FGELALMYNTPRAATIVATSEGSLWGL---------------------------------------
FNR_SHIFL       AGDLVG-FDAIGSGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSK
FNR_KLEOX       AGDLVG-FDAIGTGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSK
FNR_ECOLI       AGDLVG-FDAIGSGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSK
FNR_ECOL6       AGDLVG-FDAIGSGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSK
FNR_ECO57       AGDLVG-FDAIGSGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSK
RPGF4_HUMAN     IGTAFGE-SILDNTPRHATIVTRESSELLRIEQKD-----------------------------------
PLPL7_HUMAN     RGDLVGVVETLTHQARATTVHAVRDSELAKL---------------------------------------
KCNAE_DROME     KGDVFGDQFWKDSGQSAANVRALTYCDLHAIKRDKLLEVLD-----------------------------
HCN3_RAT        DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMM------------------------
HCN3_MOUSE      DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMM------------------------
HCN3_HUMAN      DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMM------------------------
FNR_SHIDY       AGDLVG-FDAIGSGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSK
FNR_SALTY       AGDLVG-FDAIGSGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSK
FNR_SALTI       AGDLVG-FDAIGSGHHPSFAQALETSMVCKIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSK
FNR_SALMS       AGDLVG-FDAIGSGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSK
FNR_HAEIN       PGDLVG----FD------AITQMQHPSFAQALETDILDDLAGKPKLRQQILRLMSSEIKSDQEMILLLSK
KGP1A_RABIT     KGDWFGEKALQGEDVRTANVIA------------------------------------------------
KAPR_SCHPO      KGDYFGELALIHETVRNATVQAKT----------------------------------------------
NTE1_CRYNE      QNDSIGELDVITAVDRSETVHAIRDS--------------------------------------------
FNR_ACTAC       PGDLVGFDAIMN--MQHPSFAQALETAMVCEIPFDILDDLSGKPKLRQQIMRLMSNEIKSDQEMILLLSK
ETRA_SHEON      AGDVIG----FD-GIHAQSHQSFAQALETSMVCENILDELSGTPKLRQQIMRLMSNEIMSDQEMILLLSK
KGP2_HUMAN      KGEYFGEKALISDDVRSANIIAEENDVACLVTFEELQKYLEG----------------------------
KCNH5_MOUSE     KGDVFGDIFWKETAHACANVRALTYCDLHIIKREALLKVLD-----------------------------
KAPR_NEUCR      EGGSFGELALMYNAPRAATVVS------------------------------------------------
FNR_PASMU       PGDLVGFDAIMN--MQHPSFAQALETSMVCEIPFDILDDLSGKPKLRQQIMRLMSNEIKNDQEMILLLSK
KCNH6_HUMAN     KNDIFGEVSLHQPGKSSADVRALTYCDLHKIQRADLLEVLDMYP--------------------------
KCNH5_RAT       KGDVFGDIFWKETAHACANVRALTYCDLHIIKREALLKVLD-----------------------------
KAPR_CANAL      KGDYFGELALIKDLPRQATVEALDNVIVATL---------------------------------------
HLYX_ACTPL      PGDLVGFDAIMNM-KHVGFAQALETSMICEIPF-DILDDLAGKPKIRHQIMRLMSNEIKSDQEMILLLSK
PDE5_DICDI      -GDYFGEMSLVMGGLRSANVQAVTDVEVLSFNKEDFL---------------------------------
KGP2_RAT        KGEYFGEKALISDDVRSANIIAEENDVACLVTFDELQKYLEG----------------------------
KGP2_MOUSE      KGEYFGEKALISDDVRSANIIAEENDVACLVTFDELQKYLEG----------------------------
NTE1_YARLI      KGESVGELEVLTLTRRPSTLVAIRDAELAKI---------------------------------------
KCNH5_HUMAN     KGDVFGDIFWKETAHACANVRALTYCDLHIIKREALLKVLD-----------------------------
NTE1_CANAL      HGESIGEVEVLTASRRSNTLIAVRDSETARI---------------------------------------
KGP1_DROME      AGKAFGELAILYNCTRTASIRVLSEAA-------------------------------------------
PDE6_DICDI      VGDFFGETSNFLP-TRSFTATAIDPTILLKLDIESIV---------------------------------
KAPR_COLTR      TGGSFGELALMYNAPRAATV--------------------------------------------------
RPGF3_RAT       EGDDFGQLALVNDAPRAATI--------------------------------------------------
RPGF3_HUMAN     EGDDFGQLALVNDAPRAATIILREDN--------------------------------------------
NTE1_USTMA      QGDSVGELDVITNSRRRTTLHAIRDSELAKM---------------------------------------
KCNH6_RAT       KNDIFGEPASLHPGKSSADVRALTYCDLHKIHRADLLEVLDMYP--------------------------
FNR_YERPE       --HLAGDLVGFDSNLQHPSFAQALETSMVCEIPFDTLDDLSGKPNLRQQIMRLMSGEIKGDQDMILLLSK
RPGF3_MOUSE     EGDDFGQLALVNDAPRAATI--------------------------------------------------
CNG18_ARATH     PGDFCGENSTLNLPSSTRSVRALSEVEAFALSAEDL----------------------------------
FNR_VIBCH       --HLAGDLVGFDTGDQHPSFAQALETSMVCEIPYEILDDLSGKPKLRQQIMRLMSNEIKGDQEMILLLSK
FNR_VIBC3       --HLAGDLVGFDTGDQHPSFAQALETSMVCEIPYEILDDLSGKPKLRQQIMRLMSNEIKGDQEMILLLSK
YNX5_CAEEL      EGDDFGKLALVNDLPRAATIVTYEDDS-------------------------------------------
YCF28_PORYE     TGDTFGQIELVDDN-FYYEAEAIDKTEVACINYTTIIKACSNCAPFNLFFVNHLVFCSAKAYHFIEIISH
CNGA3_BOVIN     DGSYFGEISILNGNRRTANIRSIGYSDLFCLSKDDLMEALTEYP--------------------------
CNG15_ARATH     PGDFCGEELLLDPRPSTRTVKAICEVEAFALKAEDL----------------------------------
P2C19_ARATH     KQSSFGELALMHNKPLQASVRAVDHGTLWALKRED-----------------------------------
KCNH2_RABIT     KNDIFGELNLYRPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYP--------------------------
FNRL_RHOS4      PSDFVGR-----PGRQTVAVTATTDLLMCCFRRKPFEEMMQKTPHVGQRLLEMTLDELDAAREWMLLLAR
CNGA4_HUMAN     AGLYFGEISIINGNRRTANIKSLGYSDLFCLSKEDLREVLSEYP--------------------------
KCNH3_RAT       KGDLIG----------------------------------------------------------------
KCNH3_MOUSE     KGDLIG----------------------------------------------------------------
KCNH3_HUMAN     KGDLIG----------------------------------------------------------------
CNG_DROME       AGSVFGEVSVLEGNRRTANVRSLGYSDLFCLAKRDLWETLSDYP--------------------------
CNG14_ARATH     PGDFCGE---------------------------------------------------------------
YOL4_CAEEL      RGDVLGMMEVLTKKPRATTVLAVRFSQLARVP-EGLLNFIK-----------------------------
NTE1_CANGA      QGESFGEVEVLTAMDRISSMVAVRDTELARI---------------------------------------
KCNH2_RAT       KNDIFGELNLYRPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYP--------------------------
KCNH2_MOUSE     KNDIFGELNLYRPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYP--------------------------
KCNH2_HUMAN     KNDIFGELNLYRPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYP--------------------------
KCNH2_CANFA     KNDIFGELNLYRPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYP--------------------------
FIXK_BRAJA      PGDFLG-MNLSGRHNFSAAIGAVTVCQFAKAPFG---RFIEERPQLLRRINELAIRELSQARDHMVLLGR
CNGA4_RAT       AGLYFGEISIINGNRRTANIKSLGYSDLFCLSKEDLREVLSEYP--------------------------
CNGA4_MOUSE     AGLYFGEISIINGNRRTANIKSLGYSDLFCLSKEDLREVLSEYP--------------------------
YA7B_SCHPO      CLCVVGELPFFSKTCYNATVVAELDSAVWILDRE------------------------------------
KCNH7_RAT       KNDIFGEMVHLKPGKSNADVRALTYCDLHKIQREDLLEVLDMYP--------------------------
KCNH7_MOUSE     KNDIFGEMVHLKPGKSNADVRALTYCDLHKIQREDLLEVLDMYP--------------------------
KCNH7_HUMAN     KNDIFGEMVHLKPGKSNADVRALTYCDLHKIQREDLLEVLDMYP--------------------------
KCNH1_RAT       KGDVFGDV--------------------------------------------------------------
KCNH1_MOUSE     KGDVFGDV--------------------------------------------------------------
KCNH1_HUMAN     KGDVFGDV--------------------------------------------------------------
KCNH1_BOVIN     KGDVFGDV--------------------------------------------------------------
CNGA3_HUMAN     DGSYFGEISILNGNRRTANIRSIGYSDLFCLSKDDLMEALTEYP--------------------------
CNG3_CHICK      DGSYFGEISILNGNRRTANIRSIGYSDLFCLSKDDLMEALTEYP--------------------------
CNG17_ARATH     PGDFCGE---------------------------------------------------------------
NTE1_SCHPO      KGDSVGELEMLLNNRRSSTLFAIRDSELAKI---------------------------------------
NTE1_KLULA      KGESFGEVEVLTAIHRLNTVVAIRDTELARI---------------------------------------
CNGA3_MOUSE     DGSYFGEISILNGNRRTANIRSIGYSDLFCLSKDDLMEALTEYP--------------------------
CNGA1_RAT       DGSYFGEISILNGNRRTANIKSIGYSDLFCLSKDDLMEALTEYP--------------------------
CNGA1_MOUSE     DGSYFGEISILNGNRRTANIKSIGYSDLFCLSKDDLMEALTEYP--------------------------
CNGA1_HUMAN     DGSYFGEISILNGNRRTANIKSIGYSDLFCLSKDDLMEALTEYP--------------------------
CNGA1_CANFA     DGSYFGEISILNGNRRTANIKSIGYSDLFCLSKDDLMEALTEYP--------------------------
CNGA1_BOVIN     DGSYFGEISILNGNRRTANIKSIGYSDLFCLSKDDLMEALTEYP--------------------------
CNG1_CHICK      DGSYFGEISILNGNRRTANIRSIGYSDLFCLSKDDLMEALTEYP--------------------------
CT152_MOUSE     RGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFV---------------------------------
CNGA2_MOUSE     AGSCFGEISILNGNRRTGTIRSLGYSDLFCLSKDDLME--------------------------------
YCF28_PORPU     SEDSFGHTQ-FASNRFYYEVEALDVAQVLSIEYSIIMNICQNYPNFSVFLVNHLLLCSIKANHFMEIISH
CNGB3_MOUSE     -GSVFGEISLLAKGGGNRRTADVVAHGFANL---------------------------------------
CNGA2_RAT       AGSCFGEISILNGNRRTANIRSLGYSDLFCLSKDDLME--------------------------------
CNGA2_RABIT     AGSCFGEISILNGNRRTANIRSLGYSDLFCLSKDDLME--------------------------------
CNGA2_HUMAN     AGSCFGEISILNGNRRTANIRSLGYSDLFCLSKDDLME--------------------------------
CNGA2_BOVIN     AGSCFGEISILNGNRRTANIRSLGYSDLFCLSKDDLME--------------------------------
AKT2_ARATH      CGDIFGEVGALCCRPQSYTFQTKSLSQLLRLKTSFLIETMQ-----------------------------
FNRN_RHILV      APDFVGR-----PFVRESTLSAATDSEICVFPRNLLDRMISETPELQRSLHDQALKELDAAREWMLTLGR
CNGC5_ARATH     EGEFCGELLTWALDPKSGTVKALTEVEAFALTSEEL----------------------------------


                         +         .         .         .         .         *         .:210
query           SDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRETVNKALADFASRGWLRLEPRSVVI
CRP_HAEIN       LDVAGRIAQTLMNLAKQEAMTHPDGMQI--KITRQEIGQMVGCSRETVGRIIKMLEDQNLIHAHGKTIVV
CRP_SHIFL       LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
CRP_SALTY       LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
CRP_KLEAE       LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
CRP_ECOLI       LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
CRP_ECOL6       LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
CRP_ECO57       LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
CRP_PASMU       LDVTGRIAQTLLNLAKMEAMTHPDGMQI--KITRQEIGQMVGCSRETVGRILKMLEDQHLISAHGKTIVV
VFR_PSEAE       LDVTGRVARTLLDLCQQDAMTHPDGMQI--KITRQEIGRIVGCSREMVGRVLKSLEEQGLVHVKGKTMVV
FNR_BACSU       HGKKGALYSTLIRLSNSYGVERSDGILINIVLTNQDLAKFCAAARESVNRMLGDLRKKGVISIDESGKII
NTCA_SYNE7      RDMGSRLVSFLLILCRDFGIPSPDGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLRESKLIAIHKKRITV
NTCA_SYNY3      RDMGSRLVSFLLILCRDFGVPAPDGIRIDLKLSHQAIAEAIGSTRVTVTRLLGDLREGNMISITKKKITV
NTCA_ANAVT      RDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITV
NTCA_ANASP      RDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITV
FLP_LACCA       DSINVRLTHYLLDL-----RTAAGQDTVTVPMAWTQLADYLGTTPETVSRTLKRLAEEKLIERSGKQVRI
CLP_XANCP       LDVTDRIVRTLHDLSEPEAMSHPQGTQLR--VSRQELARLVGCSREMAGRVLKKLQADGLLHARGKTVVL
Y2593_MYCBO     ----------------------------------------------------------------------
Y2564_MYCTU     ----------------------------------------------------------------------
KAPR_KLULA      ----------------------------------------------------------------------
NTE1_CHAGB      ----------------------------------------------------------------------
KAPR_YARLI      ----------------------------------------------------------------------
KAPR_ASHGO      ----------------------------------------------------------------------
NTE1_ASPTN      ----------------------------------------------------------------------
KAPR_DICDI      ----------------------------------------------------------------------
KAPR_YEAST      ----------------------------------------------------------------------
KAPR_BLAEM      ----------------------------------------------------------------------
KAPR_APLCA      ----------------------------------------------------------------------
NTE1_NEUCR      ----------------------------------------------------------------------
KAPR_TRIAT      ----------------------------------------------------------------------
CNGK1_RHILO     ----------------------------------------------------------------------
NTE1_ASPOR      ----------------------------------------------------------------------
NTE1_ASPCL      ----------------------------------------------------------------------
KAPR_CANGA      ----------------------------------------------------------------------
NTE1_COCIM      ----------------------------------------------------------------------
KAPR_ASPNG      ----------------------------------------------------------------------
KAPR2_DROME     ----------------------------------------------------------------------
CNGK1_RHIEC     ----------------------------------------------------------------------
KAP3_RAT        ----------------------------------------------------------------------
KAP3_MOUSE      ----------------------------------------------------------------------
KAP3_BOVIN      ----------------------------------------------------------------------
KAPR_EMENI      ----------------------------------------------------------------------
FNRA_PSEST      KTADERIATFLINLSARFSARGFSANQFRLPMSRNEIGNYLGLAVETVSRVFTRFQQNGLLEAEGKEVRI
Y4233_RHOPA     ----------------------------------------------------------------------
NTE1_EMENI      ----------------------------------------------------------------------
KAPR_STRPU      ----------------------------------------------------------------------
KAP3_HUMAN      ----------------------------------------------------------------------
NTE1_ASPNC      ----------------------------------------------------------------------
KAP0_PONAB      ----------------------------------------------------------------------
KAP0_HUMAN      ----------------------------------------------------------------------
KAPR_ASPFU      ----------------------------------------------------------------------
AADR_RHOPA      RSAEEKVAAFLVGWRDRLARLEGVTKTVSLPMGRQDIADFLGLTIETVSRTFTKLEREKLIVIVPDGVRV
KAPR1_DROME     ----------------------------------------------------------------------
KAP0_RAT        ----------------------------------------------------------------------
KAP0_MOUSE      ----------------------------------------------------------------------
KAP0_BOVIN      ----------------------------------------------------------------------
FIXK_RHIME      ---VERIAAFLVDLCERQG----GGRQLRLPMSRQDIADYLGLTIETVSRVVTKLKERSLIALDARTIDI
NTE1_NEOFI      ----------------------------------------------------------------------
NTE1_MAGGR      ----------------------------------------------------------------------
KAP0_PIG        ----------------------------------------------------------------------
Y2594_MYCBO     ----------------------------------------------------------------------
Y2565_MYCTU     ----------------------------------------------------------------------
SKOR_ARATH      ----------------------------------------------------------------------
KGP1B_MOUSE     ----------------------------------------------------------------------
KGP1B_BOVIN     ----------------------------------------------------------------------
KGP1A_MOUSE     ----------------------------------------------------------------------
KGP1A_BOVIN     ----------------------------------------------------------------------
KAPR_GLOLA      ----------------------------------------------------------------------
KAPR_DEBHA      ----------------------------------------------------------------------
KAP0_CHICK      ----------------------------------------------------------------------
KAPR_CAEEL      ----------------------------------------------------------------------
BTR_BORPE       MRSEQRLAAFLLNLSQRYAALGYSSTEFVLRMSREEIGNYLGLTLETVSRLFSRFGREGLIRINQREVRL
KAP2_RAT        ----------------------------------------------------------------------
ANR_PSEAE       KTADERIATFLVNLSARFRARGFSAQQFRLAMSRNEIGNYLGLAVETVSRVFTRFQQNGLISAEGKEVHI
PLPL7_RAT       ----------------------------------------------------------------------
KAP1_RAT        ----------------------------------------------------------------------
KAP1_MOUSE      ----------------------------------------------------------------------
PLPL6_PONAB     ----------------------------------------------------------------------
PLPL6_MOUSE     ----------------------------------------------------------------------
PLPL6_HUMAN     ----------------------------------------------------------------------
KAP1_HUMAN      ----------------------------------------------------------------------
HCN4_RAT        ----------------------------------------------------------------------
HCN4_RABIT      ----------------------------------------------------------------------
HCN4_MOUSE      ----------------------------------------------------------------------
HCN4_HUMAN      ----------------------------------------------------------------------
HCN1_RAT        IDRLDRIGKKNSILLQKFQKDLNTGVFNNQE--NEILKQIVKHDREMV----------------------
HCN1_RABIT      IDRLDRIGKKNSILLQKFQKDLNTGVFNNQE--NEILKQIVKHDREMV----------------------
HCN1_MOUSE      IDRLDRIGKKNSILLQKFQKDLNTGVFNNQE--NEILKQIVKHDREMV----------------------
HCN1_HUMAN      IDRLDRIGKKNSILLQKFQKDLNTGVFNNQE--NEILKQIVKHDREMV----------------------
RPGF4_MOUSE     ----------------------------------------------------------------------
NTE1_PHANO      ----------------------------------------------------------------------
KGP25_DROME     ----------------------------------------------------------------------
KGP24_DROME     ----------------------------------------------------------------------
KGP1B_HUMAN     ----------------------------------------------------------------------
KGP1A_HUMAN     ----------------------------------------------------------------------
KAPR_USTMA      ----------------------------------------------------------------------
GORK_ARATH      ----------------------------------------------------------------------
FIXK_AZOC5      KTAQERVGSFLLDLARRSGTTASHVTEVTLAMSRQDIADFLGLTIETVSRTLTYLEEQG-----------
PLPL7_MOUSE     ----------------------------------------------------------------------
NTE1_ASPFU      ----------------------------------------------------------------------
KAPR_RHIRA      ----------------------------------------------------------------------
HCN2_RAT        ----------------------------------------------------------------------
HCN2_MOUSE      ----------------------------------------------------------------------
HCN2_HUMAN      ----------------------------------------------------------------------
SWS_DROME       ----------------------------------------------------------------------
KAPR_MAGGR      ----------------------------------------------------------------------
KAP2_MOUSE      ----------------------------------------------------------------------
KAP2_HUMAN      ----------------------------------------------------------------------
KAPR_BLUGR      ----------------------------------------------------------------------
KAP2_BOVIN      ----------------------------------------------------------------------
FNR_SHIFL       KNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITI
FNR_KLEOX       KNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITI
FNR_ECOLI       KNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITI
FNR_ECOL6       KNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITI
FNR_ECO57       KNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITI
RPGF4_HUMAN     ----------------------------------------------------------------------
PLPL7_HUMAN     ----------------------------------------------------------------------
KCNAE_DROME     ----------------------------------------------------------------------
HCN3_RAT        ----------------------------------------------------------------------
HCN3_MOUSE      ----------------------------------------------------------------------
HCN3_HUMAN      ----------------------------------------------------------------------
FNR_SHIDY       KNAEERLAAFIYNLSCRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITI
FNR_SALTY       KNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITI
FNR_SALTI       KNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITI
FNR_SALMS       KNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITI
FNR_HAEIN       MNAEERLAAFIHNLSKRYSARGFSAREFRLTMTRGDIGNYLGLTVETISRLLGRFQKLGVISVQGKYITI
KGP1A_RABIT     ----------------------------------------------------------------------
KAPR_SCHPO      ----------------------------------------------------------------------
NTE1_CRYNE      ----------------------------------------------------------------------
FNR_ACTAC       MNAEERLAAFIYNLSQRYSARGFSAREFRLTMTRGDIGNYLGLTVETISRLLGRFQKLGVLSVQGKYITI
ETRA_SHEON      KNAEERLAAFISNLANRFGNRGFSAKEFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGLIEVKGKYIII
KGP2_HUMAN      ----------------------------------------------------------------------
KCNH5_MOUSE     ----------------------------------------------------------------------
KAPR_NEUCR      ----------------------------------------------------------------------
FNR_PASMU       MNAEERLAAFIYNLSRRYSARGFSAREFRLTMTRGDIGNYLGLTVETISRLLGRLQKMGILSVQGKYITI
KCNH6_HUMAN     ----------------------------------------------------------------------
KCNH5_RAT       ----------------------------------------------------------------------
KAPR_CANAL      ----------------------------------------------------------------------
HLYX_ACTPL      MSAEEKLAAFLHNLSQRYAAPGFSAREFRLTMTRGDIGNYLGLTIETISRLLGRFQKSGMITVQGKYITI
PDE5_DICDI      ----------------------------------------------------------------------
KGP2_RAT        ----------------------------------------------------------------------
KGP2_MOUSE      ----------------------------------------------------------------------
NTE1_YARLI      ----------------------------------------------------------------------
KCNH5_HUMAN     ----------------------------------------------------------------------
NTE1_CANAL      ----------------------------------------------------------------------
KGP1_DROME      ----------------------------------------------------------------------
PDE6_DICDI      ----------------------------------------------------------------------
KAPR_COLTR      ----------------------------------------------------------------------
RPGF3_RAT       ----------------------------------------------------------------------
RPGF3_HUMAN     ----------------------------------------------------------------------
NTE1_USTMA      ----------------------------------------------------------------------
KCNH6_RAT       ----------------------------------------------------------------------
FNR_YERPE       KNAEERLAAFIYNLSHRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSNILSVKGKYITI
RPGF3_MOUSE     ----------------------------------------------------------------------
CNG18_ARATH     ----------------------------------------------------------------------
FNR_VIBCH       KNAEERLAAFLYNLSTRFSQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSEILSVKGKYITI
FNR_VIBC3       KNAEERLAAFLYNLSTRFSQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSEILSVKGKYITI
YNX5_CAEEL      ----------------------------------------------------------------------
YCF28_PORYE     KSITSRXXXXXXXXXEQNGTQVNNGIMLNFTITHKILAQIIGSNRVSVTRILANLLKTKLISIQKKRIIV
CNGA3_BOVIN     ----------------------------------------------------------------------
CNG15_ARATH     ----------------------------------------------------------------------
P2C19_ARATH     ----------------------------------------------------------------------
KCNH2_RABIT     ----------------------------------------------------------------------
FNRL_RHOS4      EKXXXXXXXXXXXXXXXXXXESNGPMTFDLPLTREEMADYLGLTLETVSRQVSALKRDGVIALEKRHVIV
CNGA4_HUMAN     ----------------------------------------------------------------------
KCNH3_RAT       ----------------------------------------------------------------------
KCNH3_MOUSE     ----------------------------------------------------------------------
KCNH3_HUMAN     ----------------------------------------------------------------------
CNG_DROME       ----------------------------------------------------------------------
CNG14_ARATH     ----------------------------------------------------------------------
YOL4_CAEEL      ----------------------------------------------------------------------
NTE1_CANGA      ----------------------------------------------------------------------
KCNH2_RAT       ----------------------------------------------------------------------
KCNH2_MOUSE     ----------------------------------------------------------------------
KCNH2_HUMAN     ----------------------------------------------------------------------
KCNH2_CANFA     ----------------------------------------------------------------------
FIXK_BRAJA      RSADEKVAAFLLGWRERLLALKGASDTVPLPMSRQDIADYLGLTIETVSR--------------------
CNGA4_RAT       ----------------------------------------------------------------------
CNGA4_MOUSE     ----------------------------------------------------------------------
YA7B_SCHPO      ----------------------------------------------------------------------
KCNH7_RAT       ----------------------------------------------------------------------
KCNH7_MOUSE     ----------------------------------------------------------------------
KCNH7_HUMAN     ----------------------------------------------------------------------
KCNH1_RAT       ----------------------------------------------------------------------
KCNH1_MOUSE     ----------------------------------------------------------------------
KCNH1_HUMAN     ----------------------------------------------------------------------
KCNH1_BOVIN     ----------------------------------------------------------------------
CNGA3_HUMAN     ----------------------------------------------------------------------
CNG3_CHICK      ----------------------------------------------------------------------
CNG17_ARATH     ----------------------------------------------------------------------
NTE1_SCHPO      ----------------------------------------------------------------------
NTE1_KLULA      ----------------------------------------------------------------------
CNGA3_MOUSE     ----------------------------------------------------------------------
CNGA1_RAT       ----------------------------------------------------------------------
CNGA1_MOUSE     ----------------------------------------------------------------------
CNGA1_HUMAN     ----------------------------------------------------------------------
CNGA1_CANFA     ----------------------------------------------------------------------
CNGA1_BOVIN     ----------------------------------------------------------------------
CNG1_CHICK      ----------------------------------------------------------------------
CT152_MOUSE     ----------------------------------------------------------------------
CNGA2_MOUSE     ----------------------------------------------------------------------
YCF28_PORPU     KSITNRXXXXXXXXXEHNGISQNNGILIDLTITHKVLAQIIGSNRVSITRIISKLIHTKFISMQKKKVII
CNGB3_MOUSE     ----------------------------------------------------------------------
CNGA2_RAT       ----------------------------------------------------------------------
CNGA2_RABIT     ----------------------------------------------------------------------
CNGA2_HUMAN     ----------------------------------------------------------------------
CNGA2_BOVIN     ----------------------------------------------------------------------
AKT2_ARATH      ----------------------------------------------------------------------
FNRN_RHILV      RTAEEKVASLLHLIATHAEPQTATSTAFDLPLSRAEIADFLGLTIETVSRQMTRLRKIGVIRIENRHIIV
CNGC5_ARATH     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MDIERMARRAx
CRP_HAEIN       -----------
CRP_SHIFL       -----------
CRP_SALTY       -----------
CRP_KLEAE       -----------
CRP_ECOLI       -----------
CRP_ECOL6       -----------
CRP_ECO57       -----------
CRP_PASMU       -----------
VFR_PSEAE       -----------
FNR_BACSU       L----------
NTCA_SYNE7      FN---------
NTCA_SYNY3      -----------
NTCA_ANAVT      -----------
NTCA_ANASP      -----------
FLP_LACCA       LNAEDM-----
CLP_XANCP       -----------
Y2593_MYCBO     -----------
Y2564_MYCTU     -----------
KAPR_KLULA      -----------
NTE1_CHAGB      -----------
KAPR_YARLI      -----------
KAPR_ASHGO      -----------
NTE1_ASPTN      -----------
KAPR_DICDI      -----------
KAPR_YEAST      -----------
KAPR_BLAEM      -----------
KAPR_APLCA      -----------
NTE1_NEUCR      -----------
KAPR_TRIAT      -----------
CNGK1_RHILO     -----------
NTE1_ASPOR      -----------
NTE1_ASPCL      -----------
KAPR_CANGA      -----------
NTE1_COCIM      -----------
KAPR_ASPNG      -----------
KAPR2_DROME     -----------
CNGK1_RHIEC     -----------
KAP3_RAT        -----------
KAP3_MOUSE      -----------
KAP3_BOVIN      -----------
KAPR_EMENI      -----------
FNRA_PSEST      LD---------
Y4233_RHOPA     -----------
NTE1_EMENI      -----------
KAPR_STRPU      -----------
KAP3_HUMAN      -----------
NTE1_ASPNC      -----------
KAP0_PONAB      -----------
KAP0_HUMAN      -----------
KAPR_ASPFU      -----------
AADR_RHOPA      LDPKR------
KAPR1_DROME     -----------
KAP0_RAT        -----------
KAP0_MOUSE      -----------
KAP0_BOVIN      -----------
FIXK_RHIME      MKPEAL-----
NTE1_NEOFI      -----------
NTE1_MAGGR      -----------
KAP0_PIG        -----------
Y2594_MYCBO     -----------
Y2565_MYCTU     -----------
SKOR_ARATH      -----------
KGP1B_MOUSE     -----------
KGP1B_BOVIN     -----------
KGP1A_MOUSE     -----------
KGP1A_BOVIN     -----------
KAPR_GLOLA      -----------
KAPR_DEBHA      -----------
KAP0_CHICK      -----------
KAPR_CAEEL      -----------
BTR_BORPE       IDL--------
KAP2_RAT        -----------
ANR_PSEAE       LD---------
PLPL7_RAT       -----------
KAP1_RAT        -----------
KAP1_MOUSE      -----------
PLPL6_PONAB     -----------
PLPL6_MOUSE     -----------
PLPL6_HUMAN     -----------
KAP1_HUMAN      -----------
HCN4_RAT        -----------
HCN4_RABIT      -----------
HCN4_MOUSE      -----------
HCN4_HUMAN      -----------
HCN1_RAT        -----------
HCN1_RABIT      -----------
HCN1_MOUSE      -----------
HCN1_HUMAN      -----------
RPGF4_MOUSE     -----------
NTE1_PHANO      -----------
KGP25_DROME     -----------
KGP24_DROME     -----------
KGP1B_HUMAN     -----------
KGP1A_HUMAN     -----------
KAPR_USTMA      -----------
GORK_ARATH      -----------
FIXK_AZOC5      -----------
PLPL7_MOUSE     -----------
NTE1_ASPFU      -----------
KAPR_RHIRA      -----------
HCN2_RAT        -----------
HCN2_MOUSE      -----------
HCN2_HUMAN      -----------
SWS_DROME       -----------
KAPR_MAGGR      -----------
KAP2_MOUSE      -----------
KAP2_HUMAN      -----------
KAPR_BLUGR      -----------
KAP2_BOVIN      -----------
FNR_SHIFL       ENNDALAQLA-
FNR_KLEOX       ENSDLLAQLA-
FNR_ECOLI       ENNDALAQLA-
FNR_ECOL6       ENNDALAQLA-
FNR_ECO57       ENNDALAQLA-
RPGF4_HUMAN     -----------
PLPL7_HUMAN     -----------
KCNAE_DROME     -----------
HCN3_RAT        -----------
HCN3_MOUSE      -----------
HCN3_HUMAN      -----------
FNR_SHIDY       ENNDALAQLA-
FNR_SALTY       ENSDALAALA-
FNR_SALTI       ENSDALAALA-
FNR_SALMS       ENSDALAALA-
FNR_HAEIN       NDL--------
KGP1A_RABIT     -----------
KAPR_SCHPO      -----------
NTE1_CRYNE      -----------
FNR_ACTAC       NNMAEL-----
ETRA_SHEON      VD---------
KGP2_HUMAN      -----------
KCNH5_MOUSE     -----------
KAPR_NEUCR      -----------
FNR_PASMU       NDM--------
KCNH6_HUMAN     -----------
KCNH5_RAT       -----------
KAPR_CANAL      -----------
HLYX_ACTPL      NRMDEL-----
PDE5_DICDI      -----------
KGP2_RAT        -----------
KGP2_MOUSE      -----------
NTE1_YARLI      -----------
KCNH5_HUMAN     -----------
NTE1_CANAL      -----------
KGP1_DROME      -----------
PDE6_DICDI      -----------
KAPR_COLTR      -----------
RPGF3_RAT       -----------
RPGF3_HUMAN     -----------
NTE1_USTMA      -----------
KCNH6_RAT       -----------
FNR_YERPE       ENNEALAQLA-
RPGF3_MOUSE     -----------
CNG18_ARATH     -----------
FNR_VIBCH       LN---------
FNR_VIBC3       LN---------
YNX5_CAEEL      -----------
YCF28_PORYE     -----------
CNGA3_BOVIN     -----------
CNG15_ARATH     -----------
P2C19_ARATH     -----------
KCNH2_RABIT     -----------
FNRL_RHOS4      TDFARLLEEA-
CNGA4_HUMAN     -----------
KCNH3_RAT       -----------
KCNH3_MOUSE     -----------
KCNH3_HUMAN     -----------
CNG_DROME       -----------
CNG14_ARATH     -----------
YOL4_CAEEL      -----------
NTE1_CANGA      -----------
KCNH2_RAT       -----------
KCNH2_MOUSE     -----------
KCNH2_HUMAN     -----------
KCNH2_CANFA     -----------
FIXK_BRAJA      -----------
CNGA4_RAT       -----------
CNGA4_MOUSE     -----------
YA7B_SCHPO      -----------
KCNH7_RAT       -----------
KCNH7_MOUSE     -----------
KCNH7_HUMAN     -----------
KCNH1_RAT       -----------
KCNH1_MOUSE     -----------
KCNH1_HUMAN     -----------
KCNH1_BOVIN     -----------
CNGA3_HUMAN     -----------
CNG3_CHICK      -----------
CNG17_ARATH     -----------
NTE1_SCHPO      -----------
NTE1_KLULA      -----------
CNGA3_MOUSE     -----------
CNGA1_RAT       -----------
CNGA1_MOUSE     -----------
CNGA1_HUMAN     -----------
CNGA1_CANFA     -----------
CNGA1_BOVIN     -----------
CNG1_CHICK      -----------
CT152_MOUSE     -----------
CNGA2_MOUSE     -----------
YCF28_PORPU     HDPILLSQR--
CNGB3_MOUSE     -----------
CNGA2_RAT       -----------
CNGA2_RABIT     -----------
CNGA2_HUMAN     -----------
CNGA2_BOVIN     -----------
AKT2_ARATH      -----------
FNRN_RHILV      PDMDELER---
CNGC5_ARATH     -----------