[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_00411

[Show Plain Result]

#ERROR : Can't open dsspfile "1eduA.bssp"
#ERROR : Can't open dsspfile "2b0hA.bssp"

## Summary of PDB Search
:1056
    4e-17  16%  1eduA  [a.118.9] EH DOMAIN BINDING PROTEIN EPSIN
    2e-14  15%  2b0hA  [x.x.x] TALIN-1
:1056

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxNIDMSRTEADLAVNIRKATSIEETAPKRKHVRSCIVYTWDHKSSASFWAGMKVQPVLAD
1eduA           -----------NIVHNYSEAEIKV--REATSNDPWGPSSSLSEIADLTYNVVAFSEISIW-KRLNDHGKN
2b0hA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EVQTFKALITVHKVLQEGHPITVKEAQSHVPWLDSLVRGVAGEGLRGYGPLIREYVFYLxxxxxxxxxxx
1eduA           WRHVYKATL--EYLIKTGSERVSQQCKENYAVQTLKDFQYVDRDGKDQGVNVREKAKQL-----------
2b0hA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1eduA           ----------------------------------------------------------------------
2b0hA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1eduA           ----------------------------------------------------------------------
2b0hA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1eduA           ----------------------------------------------------------------------
2b0hA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1eduA           ----------------------------------------------------------------------
2b0hA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1eduA           ----------------------------------------------------------------------
2b0hA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1eduA           ----------------------------------------------------------------------
2b0hA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1eduA           ----------------------------------------------------------------------
2b0hA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1eduA           ----------------------------------------------------------------------
2b0hA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1eduA           ----------------------------------------------------------------------
2b0hA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1eduA           ----------------------------------------------------------------------
2b0hA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAELIKAATASQQEIVREGRGSSSRTAFYKKNNR
1eduA           ----------------------------------------------------------------------
2b0hA           -------------------------------------GDPEGSFVDYQTTMVRTAKAAVTVQEMVTKSNT


                         .         .         .         +         .         .         .:980
query           WTEGLISAAKAVATSTNTLIETADGVISGRNSPEQLIVASNDVAASTAQLVAASRVKATFMSKTQDRLET
1eduA           ----------------------------------------------------------------------
2b0hA           SPEELGPLANQLTSDYGRLASQAKPAAVAAENEEHIKHRVQELGHGCSALVTKAGALQCSPVYTKKELIE


                         .         *         .         .         .         .         +:1050
query           ASKAVGAACRALVRQVQAIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1eduA           ----------------------------------------------------------------------
2b0hA           CARRVSEKVSHVLAALQAG---------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxx
1eduA           ------
2b0hA           ------