[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_00429

[Show Plain Result]

#ERROR : Can't open dsspfile "1a7wA.bssp"
#ERROR : Can't open dsspfile "1b67A.bssp"
#ERROR : Can't open dsspfile "1bfmA.bssp"
#ERROR : Can't open dsspfile "1b67B.bssp"
#ERROR : Can't open dsspfile "1b6wA.bssp"
#ERROR : Can't open dsspfile "3c9kB.bssp"
#ERROR : Can't open dsspfile "2cv5D.bssp"
#ERROR : Can't open dsspfile "2cv5E.bssp"
#ERROR : Can't open dsspfile "2bykB.bssp"
#ERROR : Can't open dsspfile "2bymB.bssp"
#ERROR : Can't open dsspfile "1aoiG.bssp"
#ERROR : Can't open dsspfile "3c1bF.bssp"
#ERROR : Can't open dsspfile "1aoiC.bssp"
#ERROR : Can't open dsspfile "1aoiF.bssp"
#ERROR : Can't open dsspfile "2cv5F.bssp"
#ERROR : Can't open dsspfile "3b6fA.bssp"
#ERROR : Can't open dsspfile "3c1cH.bssp"
#ERROR : Can't open dsspfile "2cv5H.bssp"
#ERROR : Can't open dsspfile "1aoiD.bssp"
#ERROR : Can't open dsspfile "1aoiA.bssp"
#ERROR : Can't open dsspfile "2bykD.bssp"
#ERROR : Can't open dsspfile "2cv5C.bssp"
#ERROR : Can't open dsspfile "3c1cE.bssp"
#ERROR : Can't open dsspfile "2cv5G.bssp"
#ERROR : Can't open dsspfile "1aoiE.bssp"
#ERROR : Can't open dsspfile "3b6fG.bssp"

## Summary of PDB Search
:476
    6e-08  21%  1a7wA  [x.x.x] HISTONE HMFB
    6e-08  26%  1b67A  [a.22.1] PROTEIN (HISTONE HMFA)
    2e-07  21%  1bfmA  [a.22.1] HISTONE B
    5e-07  27%  1b67B  [a.22.1] PROTEIN (HISTONE HMFA)
    6e-07  23%  1b6wA  [a.22.1] PROTEIN (HISTONE HMFB)
    8e-07  14%  3c9kB  [x.x.x] HISTONE H2B 7
    1e-06  15%  2cv5D  [x.x.x] HISTONE H2B K
    2e-06  17%  2cv5E  [x.x.x] HISTONE H3.1
    3e-06  24%  2bykB  [x.x.x] CHRAC-14
    3e-06  24%  2bymB  [x.x.x] CHRAC-14
    6e-06  12%  1aoiG  [a.22.1] HISTONE H2A
    9e-06  34%  3c1bF  [x.x.x] HISTONE H4
    1e-05  14%  1aoiC  [a.22.1] HISTONE H2A
    1e-05  32%  1aoiF  [a.22.1] HISTONE H4
    1e-05  34%  2cv5F  [x.x.x] HISTONE H4
    2e-05  21%  3b6fA  [x.x.x] HISTONE H3.2
    3e-05  14%  3c1cH  [x.x.x] HISTONE 2, H2BF
    3e-05  14%  2cv5H  [x.x.x] HISTONE H2B K
    4e-05  15%  1aoiD  [a.22.1] HISTONE H2B
    5e-05  17%  1aoiA  [a.22.1] HISTONE H3
    2e-04  26%  2bykD  [x.x.x] CHRAC-14
    3e-04  15%  2cv5C  [x.x.x] HISTONE H2A.A
    5e-04  19%  3c1cE  [x.x.x] HISTONE H3-LIKE
    6e-04  17%  2cv5G  [x.x.x] HISTONE H2A.A
    8e-04  20%  1aoiE  [a.22.1] HISTONE H3
    0.001  20%  3b6fG  [x.x.x] HISTONE H2A
:476

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1a7wA           ----------------------------------------------------------------------
1b67A           ----------------------------------------------------------------------
1bfmA           ----------------------------------------------------------------------
1b67B           ----------------------------------------------------------------------
1b6wA           ----------------------------------------------------------------------
3c9kB           ----------------------------------------------------------------------
2cv5D           ----------------------------------------------------------------------
2cv5E           ----------------------------------------------------------------------
2bykB           ----------------------------------------------------------------------
2bymB           ----------------------------------------------------------------------
1aoiG           ----------------------------------------------------------------------
3c1bF           ----------------------------------------------------------------------
1aoiC           ----------------------------------------------------------------------
1aoiF           ----------------------------------------------------------------------
2cv5F           ----------------------------------------------------------------------
3b6fA           ----------------------------------------------------------------------
3c1cH           ----------------------------------------------------------------------
2cv5H           ----------------------------------------------------------------------
1aoiD           ----------------------------------------------------------------------
1aoiA           ----------------------------------------------------------------------
2bykD           ----------------------------------------------------------------------
2cv5C           ----------------------------------------------------------------------
3c1cE           ----------------------------------------------------------------------
2cv5G           ----------------------------------------------------------------------
1aoiE           ----------------------------------------------------------------------
3b6fG           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1a7wA           ----------------------------------------------------------------------
1b67A           ----------------------------------------------------------------------
1bfmA           ----------------------------------------------------------------------
1b67B           ----------------------------------------------------------------------
1b6wA           ----------------------------------------------------------------------
3c9kB           ----------------------------------------------------------------------
2cv5D           ----------------------------------------------------------------------
2cv5E           ----------------------------------------------------------------------
2bykB           ----------------------------------------------------------------------
2bymB           ----------------------------------------------------------------------
1aoiG           ----------------------------------------------------------------------
3c1bF           ----------------------------------------------------------------------
1aoiC           ----------------------------------------------------------------------
1aoiF           ----------------------------------------------------------------------
2cv5F           ----------------------------------------------------------------------
3b6fA           ----------------------------------------------------------------------
3c1cH           ----------------------------------------------------------------------
2cv5H           ----------------------------------------------------------------------
1aoiD           ----------------------------------------------------------------------
1aoiA           ----------------------------------------------------------------------
2bykD           ----------------------------------------------------------------------
2cv5C           ----------------------------------------------------------------------
3c1cE           ----------------------------------------------------------------------
2cv5G           ----------------------------------------------------------------------
1aoiE           ----------------------------------------------------------------------
3b6fG           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1a7wA           ----------------------------------------------------------------------
1b67A           ----------------------------------------------------------------------
1bfmA           ----------------------------------------------------------------------
1b67B           ----------------------------------------------------------------------
1b6wA           ----------------------------------------------------------------------
3c9kB           ----------------------------------------------------------------------
2cv5D           ----------------------------------------------------------------------
2cv5E           ----------------------------------------------------------------------
2bykB           ----------------------------------------------------------------------
2bymB           ----------------------------------------------------------------------
1aoiG           ----------------------------------------------------------------------
3c1bF           ----------------------------------------------------------------------
1aoiC           ----------------------------------------------------------------------
1aoiF           ----------------------------------------------------------------------
2cv5F           ----------------------------------------------------------------------
3b6fA           ----------------------------------------------------------------------
3c1cH           ----------------------------------------------------------------------
2cv5H           ----------------------------------------------------------------------
1aoiD           ----------------------------------------------------------------------
1aoiA           ----------------------------------------------------------------------
2bykD           ----------------------------------------------------------------------
2cv5C           ----------------------------------------------------------------------
3c1cE           ----------------------------------------------------------------------
2cv5G           ----------------------------------------------------------------------
1aoiE           ----------------------------------------------------------------------
3b6fG           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1a7wA           ----------------------------------------------------------------------
1b67A           ----------------------------------------------------------------------
1bfmA           ----------------------------------------------------------------------
1b67B           ----------------------------------------------------------------------
1b6wA           ----------------------------------------------------------------------
3c9kB           ----------------------------------------------------------------------
2cv5D           ----------------------------------------------------------------------
2cv5E           ----------------------------------------------------------------------
2bykB           ----------------------------------------------------------------------
2bymB           ----------------------------------------------------------------------
1aoiG           ----------------------------------------------------------------------
3c1bF           ----------------------------------------------------------------------
1aoiC           ----------------------------------------------------------------------
1aoiF           ----------------------------------------------------------------------
2cv5F           ----------------------------------------------------------------------
3b6fA           ----------------------------------------------------------------------
3c1cH           ----------------------------------------------------------------------
2cv5H           ----------------------------------------------------------------------
1aoiD           ----------------------------------------------------------------------
1aoiA           ----------------------------------------------------------------------
2bykD           ----------------------------------------------------------------------
2cv5C           ----------------------------------------------------------------------
3c1cE           ----------------------------------------------------------------------
2cv5G           ----------------------------------------------------------------------
1aoiE           ----------------------------------------------------------------------
3b6fG           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1a7wA           ----------------------------------------------------------------------
1b67A           ----------------------------------------------------------------------
1bfmA           ----------------------------------------------------------------------
1b67B           ----------------------------------------------------------------------
1b6wA           ----------------------------------------------------------------------
3c9kB           ----------------------------------------------------------------------
2cv5D           ----------------------------------------------------------------------
2cv5E           ----------------------------------------------------------------------
2bykB           ----------------------------------------------------------------------
2bymB           ----------------------------------------------------------------------
1aoiG           ----------------------------------------------------------------------
3c1bF           ----------------------------------------------------------------------
1aoiC           ----------------------------------------------------------------------
1aoiF           ----------------------------------------------------------------------
2cv5F           ----------------------------------------------------------------------
3b6fA           ----------------------------------------------------------------------
3c1cH           ----------------------------------------------------------------------
2cv5H           ----------------------------------------------------------------------
1aoiD           ----------------------------------------------------------------------
1aoiA           ----------------------------------------------------------------------
2bykD           ----------------------------------------------------------------------
2cv5C           ----------------------------------------------------------------------
3c1cE           ----------------------------------------------------------------------
2cv5G           ----------------------------------------------------------------------
1aoiE           ----------------------------------------------------------------------
3b6fG           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxQNKERVSKHGIPVPKLPRGIVKRLATRFARTGNGSRTRISKEALAALEKATDWFFEQAND
1a7wA           -------------------------LPIAPIGRIIKD------AGAERVSDDARITLAKILEEMGRDIAS
1b67A           ------------------------ELPIAPIGRIIKN------AGAERVSDDARIALAKVLEEMGEEIAS
1bfmA           -------------------------LPIAPIGRIIKD------AGAERVSDDARITLAKILEEMGRDIAS
1b67B           -------------------------LPIAPIGRIIKN------AGAERVSDDARIALAKVLEEMGEEIAS
1b6wA           ------------------------ELPIAPIGRIIKD------AGAERVSDDARITLAKILEEGRDIA-S
3c9kB           -------------------------------SIYVYKVLKQVHPD-TGISSKAMSIMNSFVNDIFERIAG
2cv5D           -------------------------SYSVYVYKVL----KQVHPD-TGISSKAMGIMNSFVNDIFERIAG
2cv5E           ------------REIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL-RFQSSAVMALQEACEAYLVGLFE
2bykB           --------------------------PNAVIGRLI----KEALPESASVSKEARAAIARAASVFAIFVTS
2bymB           -----------------------------VIGRLI----KEALPESASVSKEARAAIARAASVFAIFVTS
1aoiG           --------------AKTRSSRAGLQFPVGRVHRLLRKG-----NYAERVGAGAPVYLAAVLEYLTAEILE
3c1bF           -------------------------ITKPAIRRLARR------GGVKRISGLIYEETRGVLKVFLENVIR
1aoiC           ------------AKAKTRSSRAGLQFPVGRVHR----LLRKGNYA-ERVGAGAPVYLAAVLEYLTAEILE
1aoiF           -------------------------ITKPAIRRLAR------RGGVKRISGLIYEETRGVLKVFLENVIR
2cv5F           -------------------------ITKPAIRRLARR------GGVKRISGLIYEETRGVLKVFLENVIR
3b6fA           ----------QKSTELLIRKLPFQRLVREIAQDFKTD---------LRFQSSAVMALQEASEAYLVALFE
3c1cH           -------------------------SYAIYVYKVLKQVHPDT-----GISSKAMSIMNSFVNDVFERIAG
2cv5H           -------------------------------SVYVYKVLKQVHPD-TGISSKAMGIMNSFVNDIFERIAG
1aoiD           -------------------------SYAIYVYKVLKQVHPD-----TGISSKAMSIMNSFVNDVFERIAG
1aoiA           -----------------YQKSTELLIRKLPFQRLVREIAQDFKTD-LRFQSSAVMALQEASEAYLVALFE
2bykD           -------------------------LPNAVIGRLI----KEALPESASVSKEARAAIARAASVFAIFVTS
2cv5C           ------------AKAKTRSSRAGLQFPVGRVHRLL----RKGNYSE-RVGAGAPVYLAAVLEYLTAEILE
3c1cE           -------------------------IRKLPFQRLVREIAQ--DFTDLRFQSSAVMALQEASEAYLVALFE
2cv5G           -------------------------FPVGRVHRLL----RKGNY-SERVGAGAPVYLAAVLEYLTAEILE
1aoiE           ----------------------------------------------LRFQSSAVMALQEASEAYLVALFE
3b6fG           ------------KTRSSRAGL---QFPVGRVHRLL----RKGNYA-ERVGAGAPVYLAAVLEYLTAEILE


                         .         .         +         .         .         .         .:490
query           DLSAYSKHSNRKTVDETDVIALMKRQRQIGKGTSVFALAQxxxxxxxxxxxxxxxx
1a7wA           EAIKLARHAGRKTIKAEDIELAVRRFK-----------------------------
1b67A           EAVKLAKHAGRKTIKAEDIELARKM-------------------------------
1bfmA           EAIKLARHAGRKTIKAEDIELAVRRFKK----------------------------
1b67B           EAVKLAKHAGRKTIKAEDIELARK--------------------------------
1b6wA           EAIKLARHAGRKTIKAEDIELAVRRFK-----------------------------
3c9kB           EASRLAHYNKRSTITSREIQTAVRLL------------------------------
2cv5D           EASRLAHYNKRSTITSREIQTAVRLL------------------------------
2cv5E           DTNLCAIHAKRVTIMPKDIQLARRIR------------------------------
2bykB           SSTALAHKQNHKTITAKDILQTLTEL------------------------------
2bymB           SSTALAHKQNHKTITAKDILQTLTE-------------------------------
1aoiG           LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQ----------------
3c1bF           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1aoiC           LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQ----------------
1aoiF           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
2cv5F           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
3b6fA           DTNLCAIHAKRVTIMPKDIQLARRIR------------------------------
3c1cH           EASRLAHYNKRSTITSREIQTAVRLL------------------------------
2cv5H           EASRLAHYNKRSTITSREIQTAVRL-------------------------------
1aoiD           EASRLAHYNKRSTITSREIQTAVRLL------------------------------
1aoiA           DTNLCAIHAKRVTIMPKDIQLARRIR------------------------------
2bykD           SSTALAHKQNHKTITAKDILQTLTE-------------------------------
2cv5C           LAGNAARDNKKTRIIPRHLQLAIRND------------------------------
3c1cE           DTNLAAIHAKRVTIMPKDIQLARRIR------------------------------
2cv5G           LAGNAARDNKKTRIIPRHLQLAIRND------------------------------
1aoiE           DTNLCAIHAKRVTIMPKDIQLARRIR------------------------------
3b6fG           LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQ----------------