[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_00735

[Show Plain Result]

#ERROR : Can't open dsspfile "2de0X.bssp"
#ERROR : Can't open dsspfile "2drmA.bssp"
#ERROR : Can't open dsspfile "2b86A.bssp"
#ERROR : Can't open dsspfile "3eg0A.bssp"
#ERROR : Can't open dsspfile "1aojA.bssp"
#ERROR : Can't open dsspfile "3c0cA.bssp"
#ERROR : Can't open dsspfile "2dybB.bssp"
#ERROR : Can't open dsspfile "2a36A.bssp"
#ERROR : Can't open dsspfile "1ckaA.bssp"
#ERROR : Can't open dsspfile "2ak5A.bssp"
#ERROR : Can't open dsspfile "2d1xB.bssp"
#ERROR : Can't open dsspfile "2drkA.bssp"
#ERROR : Can't open dsspfile "2a37A.bssp"
#ERROR : Can't open dsspfile "1b07A.bssp"
#ERROR : Can't open dsspfile "2bz8B.bssp"
#ERROR : Can't open dsspfile "1awwA.bssp"
#ERROR : Can't open dsspfile "1efnA.bssp"
#ERROR : Can't open dsspfile "2a28A.bssp"
#ERROR : Can't open dsspfile "2csqA.bssp"
#ERROR : Can't open dsspfile "2dbmA.bssp"
#ERROR : Can't open dsspfile "3eg2A.bssp"
#ERROR : Can't open dsspfile "1avzC.bssp"
#ERROR : Can't open dsspfile "1bbzA.bssp"
#ERROR : Can't open dsspfile "1aeyA.bssp"
#ERROR : Can't open dsspfile "2cdtA.bssp"
#ERROR : Can't open dsspfile "1bu1C.bssp"
#ERROR : Can't open dsspfile "2d0nA.bssp"
#ERROR : Can't open dsspfile "2dybA.bssp"
#ERROR : Can't open dsspfile "2ct3A.bssp"
#ERROR : Can't open dsspfile "2egcA.bssp"
#ERROR : Can't open dsspfile "2d1xC.bssp"
#ERROR : Can't open dsspfile "2ak5B.bssp"
#ERROR : Can't open dsspfile "2dl4A.bssp"
#ERROR : Can't open dsspfile "2a08A.bssp"
#ERROR : Can't open dsspfile "1awoA.bssp"
#ERROR : Can't open dsspfile "2bzyA.bssp"
#ERROR : Can't open dsspfile "2dlmA.bssp"
#ERROR : Can't open dsspfile "1bk2A.bssp"
#ERROR : Can't open dsspfile "2dxcG.bssp"
#ERROR : Can't open dsspfile "1e6hA.bssp"
#ERROR : Can't open dsspfile "3cqtA.bssp"
#ERROR : Can't open dsspfile "2bz8A.bssp"

## Summary of PDB Search
:505
    6e-06  21%  2de0X  [x.x.x] ALPHA-(1,6)-FUCOSYLTRANSFERASE
    2e-05  26%  2drmA  [x.x.x] ACANTHAMOEBA MYOSIN IB
    2e-05  14%  2b86A  [x.x.x] CYTOPLASMIC PROTEIN NCK2
    2e-05  15%  3eg0A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-05  12%  1aojA  [b.34.2] EPS8
    4e-05  21%  3c0cA  [x.x.x] ENDOPHILIN-A2
    4e-05   8%  2dybB  [x.x.x] NEUTROPHIL CYTOSOL FACTOR 4
    4e-05  20%  2a36A  [x.x.x] PROTEIN E(SEV)2B
    5e-05  15%  1ckaA  [b.34.2] C-CRK N-TERMINAL SH3 DOMAIN
    6e-05  23%  2ak5A  [x.x.x] RHO GUANINE NUCLEOTIDE EXCHANGE FACTOR 7
    6e-05  26%  2d1xB  [x.x.x] CORTACTIN ISOFORM A
    8e-05  26%  2drkA  [x.x.x] MYOSIN HEAVY CHAIN IB
    8e-05  22%  2a37A  [x.x.x] PROTEIN E(SEV)2B
    1e-04  15%  1b07A  [b.34.2] PROTEIN (PROTO-ONCOGENE CRK (CRK))
    1e-04  23%  2bz8B  [x.x.x] SH3-DOMAIN KINASE BINDING PROTEIN 1
    1e-04  27%  1awwA  [x.x.x] BRUTON'S TYROSINE KINASE
    1e-04  15%  1efnA  [b.34.2] FYN TYROSINE KINASE
    2e-04  22%  2a28A  [x.x.x] BZZ1 PROTEIN
    2e-04  12%  2csqA  [x.x.x] RIM BINDING PROTEIN 2
    3e-04  19%  2dbmA  [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
    3e-04  14%  3eg2A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-04  18%  1avzC  [b.34.2] FYN TYROSINE KINASE
    3e-04  14%  1bbzA  [b.34.2] ABL TYROSINE KINASE
    3e-04  21%  1aeyA  [x.x.x] ALPHA-SPECTRIN
    3e-04  20%  2cdtA  [x.x.x] SPECTRIN ALPHA CHAIN
    4e-04  18%  1bu1C  [b.34.2] PROTEIN (HEMOPOIETIC CELL KINASE)
    4e-04  21%  2d0nA  [x.x.x] GRB2-RELATED ADAPTOR PROTEIN 2
    4e-04  15%  2dybA  [x.x.x] NEUTROPHIL CYTOSOL FACTOR 4
    5e-04  35%  2ct3A  [x.x.x] VINEXIN
    5e-04  15%  2egcA  [x.x.x] SH3 AND PX DOMAIN-CONTAINING PROTEIN 2A
    5e-04  23%  2d1xC  [x.x.x] CORTACTIN ISOFORM A
    5e-04  26%  2ak5B  [x.x.x] RHO GUANINE NUCLEOTIDE EXCHANGE FACTOR 7
    5e-04  15%  2dl4A  [x.x.x] PROTEIN STAC
    5e-04  10%  2a08A  [x.x.x] HYPOTHETICAL 41.8 KDA PROTEIN IN SPO13-ARG4
    5e-04  15%  1awoA  [x.x.x] ABL TYROSINE KINASE
    5e-04  22%  2bzyA  [x.x.x] CRK-LIKE PROTEIN
    7e-04  19%  2dlmA  [x.x.x] VINEXIN
    7e-04  20%  1bk2A  [x.x.x] A-SPECTRIN
    7e-04  10%  2dxcG  [x.x.x] THIOCYANATE HYDROLASE SUBUNIT ALPHA
    9e-04  22%  1e6hA  [b.34.2] SPECTRIN ALPHA CHAIN
    9e-04  18%  3cqtA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE FYN
    0.001  23%  2bz8A  [x.x.x] SH3-DOMAIN KINASE BINDING PROTEIN 1
:505

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2de0X           ----------------------------------------------------------------------
2drmA           ----------------------------------------------------------------------
2b86A           ----------------------------------------------------------------------
3eg0A           ----------------------------------------------------------------------
1aojA           ----------------------------------------------------------------------
3c0cA           ----------------------------------------------------------------------
2dybB           ----------------------------------------------------------------------
2a36A           ----------------------------------------------------------------------
1ckaA           ----------------------------------------------------------------------
2ak5A           ----------------------------------------------------------------------
2d1xB           ----------------------------------------------------------------------
2drkA           ----------------------------------------------------------------------
2a37A           ----------------------------------------------------------------------
1b07A           ----------------------------------------------------------------------
2bz8B           ----------------------------------------------------------------------
1awwA           ----------------------------------------------------------------------
1efnA           ----------------------------------------------------------------------
2a28A           ----------------------------------------------------------------------
2csqA           ----------------------------------------------------------------------
2dbmA           ----------------------------------------------------------------------
3eg2A           ----------------------------------------------------------------------
1avzC           ----------------------------------------------------------------------
1bbzA           ----------------------------------------------------------------------
1aeyA           ----------------------------------------------------------------------
2cdtA           ----------------------------------------------------------------------
1bu1C           ----------------------------------------------------------------------
2d0nA           ----------------------------------------------------------------------
2dybA           ----------------------------------------------------------------------
2ct3A           ----------------------------------------------------------------------
2egcA           ----------------------------------------------------------------------
2d1xC           ----------------------------------------------------------------------
2ak5B           ----------------------------------------------------------------------
2dl4A           ----------------------------------------------------------------------
2a08A           ----------------------------------------------------------------------
1awoA           ----------------------------------------------------------------------
2bzyA           ----------------------------------------------------------------------
2dlmA           ----------------------------------------------------------------------
1bk2A           ----------------------------------------------------------------------
2dxcG           ----------------------------------------------------------------------
1e6hA           ----------------------------------------------------------------------
3cqtA           ----------------------------------------------------------------------
2bz8A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2de0X           ----------------------------------------------------------------------
2drmA           ----------------------------------------------------------------------
2b86A           ----------------------------------------------------------------------
3eg0A           ----------------------------------------------------------------------
1aojA           ----------------------------------------------------------------------
3c0cA           ----------------------------------------------------------------------
2dybB           ----------------------------------------------------------------------
2a36A           ----------------------------------------------------------------------
1ckaA           ----------------------------------------------------------------------
2ak5A           ----------------------------------------------------------------------
2d1xB           ----------------------------------------------------------------------
2drkA           ----------------------------------------------------------------------
2a37A           ----------------------------------------------------------------------
1b07A           ----------------------------------------------------------------------
2bz8B           ----------------------------------------------------------------------
1awwA           ----------------------------------------------------------------------
1efnA           ----------------------------------------------------------------------
2a28A           ----------------------------------------------------------------------
2csqA           ----------------------------------------------------------------------
2dbmA           ----------------------------------------------------------------------
3eg2A           ----------------------------------------------------------------------
1avzC           ----------------------------------------------------------------------
1bbzA           ----------------------------------------------------------------------
1aeyA           ----------------------------------------------------------------------
2cdtA           ----------------------------------------------------------------------
1bu1C           ----------------------------------------------------------------------
2d0nA           ----------------------------------------------------------------------
2dybA           ----------------------------------------------------------------------
2ct3A           ----------------------------------------------------------------------
2egcA           ----------------------------------------------------------------------
2d1xC           ----------------------------------------------------------------------
2ak5B           ----------------------------------------------------------------------
2dl4A           ----------------------------------------------------------------------
2a08A           ----------------------------------------------------------------------
1awoA           ----------------------------------------------------------------------
2bzyA           ----------------------------------------------------------------------
2dlmA           ----------------------------------------------------------------------
1bk2A           ----------------------------------------------------------------------
2dxcG           ----------------------------------------------------------------------
1e6hA           ----------------------------------------------------------------------
3cqtA           ----------------------------------------------------------------------
2bz8A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2de0X           ----------------------------------------------------------------------
2drmA           ----------------------------------------------------------------------
2b86A           ----------------------------------------------------------------------
3eg0A           ----------------------------------------------------------------------
1aojA           ----------------------------------------------------------------------
3c0cA           ----------------------------------------------------------------------
2dybB           ----------------------------------------------------------------------
2a36A           ----------------------------------------------------------------------
1ckaA           ----------------------------------------------------------------------
2ak5A           ----------------------------------------------------------------------
2d1xB           ----------------------------------------------------------------------
2drkA           ----------------------------------------------------------------------
2a37A           ----------------------------------------------------------------------
1b07A           ----------------------------------------------------------------------
2bz8B           ----------------------------------------------------------------------
1awwA           ----------------------------------------------------------------------
1efnA           ----------------------------------------------------------------------
2a28A           ----------------------------------------------------------------------
2csqA           ----------------------------------------------------------------------
2dbmA           ----------------------------------------------------------------------
3eg2A           ----------------------------------------------------------------------
1avzC           ----------------------------------------------------------------------
1bbzA           ----------------------------------------------------------------------
1aeyA           ----------------------------------------------------------------------
2cdtA           ----------------------------------------------------------------------
1bu1C           ----------------------------------------------------------------------
2d0nA           ----------------------------------------------------------------------
2dybA           ----------------------------------------------------------------------
2ct3A           ----------------------------------------------------------------------
2egcA           ----------------------------------------------------------------------
2d1xC           ----------------------------------------------------------------------
2ak5B           ----------------------------------------------------------------------
2dl4A           ----------------------------------------------------------------------
2a08A           ----------------------------------------------------------------------
1awoA           ----------------------------------------------------------------------
2bzyA           ----------------------------------------------------------------------
2dlmA           ----------------------------------------------------------------------
1bk2A           ----------------------------------------------------------------------
2dxcG           ----------------------------------------------------------------------
1e6hA           ----------------------------------------------------------------------
3cqtA           ----------------------------------------------------------------------
2bz8A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2de0X           ----------------------------------------------------------------------
2drmA           ----------------------------------------------------------------------
2b86A           ----------------------------------------------------------------------
3eg0A           ----------------------------------------------------------------------
1aojA           ----------------------------------------------------------------------
3c0cA           ----------------------------------------------------------------------
2dybB           ----------------------------------------------------------------------
2a36A           ----------------------------------------------------------------------
1ckaA           ----------------------------------------------------------------------
2ak5A           ----------------------------------------------------------------------
2d1xB           ----------------------------------------------------------------------
2drkA           ----------------------------------------------------------------------
2a37A           ----------------------------------------------------------------------
1b07A           ----------------------------------------------------------------------
2bz8B           ----------------------------------------------------------------------
1awwA           ----------------------------------------------------------------------
1efnA           ----------------------------------------------------------------------
2a28A           ----------------------------------------------------------------------
2csqA           ----------------------------------------------------------------------
2dbmA           ----------------------------------------------------------------------
3eg2A           ----------------------------------------------------------------------
1avzC           ----------------------------------------------------------------------
1bbzA           ----------------------------------------------------------------------
1aeyA           ----------------------------------------------------------------------
2cdtA           ----------------------------------------------------------------------
1bu1C           ----------------------------------------------------------------------
2d0nA           ----------------------------------------------------------------------
2dybA           ----------------------------------------------------------------------
2ct3A           ----------------------------------------------------------------------
2egcA           ----------------------------------------------------------------------
2d1xC           ----------------------------------------------------------------------
2ak5B           ----------------------------------------------------------------------
2dl4A           ----------------------------------------------------------------------
2a08A           ----------------------------------------------------------------------
1awoA           ----------------------------------------------------------------------
2bzyA           ----------------------------------------------------------------------
2dlmA           ----------------------------------------------------------------------
1bk2A           ----------------------------------------------------------------------
2dxcG           ----------------------------------------------------------------------
1e6hA           ----------------------------------------------------------------------
3cqtA           ----------------------------------------------------------------------
2bz8A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2de0X           ----------------------------------------------------------------------
2drmA           ----------------------------------------------------------------------
2b86A           ----------------------------------------------------------------------
3eg0A           ----------------------------------------------------------------------
1aojA           ----------------------------------------------------------------------
3c0cA           ----------------------------------------------------------------------
2dybB           ----------------------------------------------------------------------
2a36A           ----------------------------------------------------------------------
1ckaA           ----------------------------------------------------------------------
2ak5A           ----------------------------------------------------------------------
2d1xB           ----------------------------------------------------------------------
2drkA           ----------------------------------------------------------------------
2a37A           ----------------------------------------------------------------------
1b07A           ----------------------------------------------------------------------
2bz8B           ----------------------------------------------------------------------
1awwA           ----------------------------------------------------------------------
1efnA           ----------------------------------------------------------------------
2a28A           ----------------------------------------------------------------------
2csqA           ----------------------------------------------------------------------
2dbmA           ----------------------------------------------------------------------
3eg2A           ----------------------------------------------------------------------
1avzC           ----------------------------------------------------------------------
1bbzA           ----------------------------------------------------------------------
1aeyA           ----------------------------------------------------------------------
2cdtA           ----------------------------------------------------------------------
1bu1C           ----------------------------------------------------------------------
2d0nA           ----------------------------------------------------------------------
2dybA           ----------------------------------------------------------------------
2ct3A           ----------------------------------------------------------------------
2egcA           ----------------------------------------------------------------------
2d1xC           ----------------------------------------------------------------------
2ak5B           ----------------------------------------------------------------------
2dl4A           ----------------------------------------------------------------------
2a08A           ----------------------------------------------------------------------
1awoA           ----------------------------------------------------------------------
2bzyA           ----------------------------------------------------------------------
2dlmA           ----------------------------------------------------------------------
1bk2A           ----------------------------------------------------------------------
2dxcG           ----------------------------------------------------------------------
1e6hA           ----------------------------------------------------------------------
3cqtA           ----------------------------------------------------------------------
2bz8A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxSPKSGSGAQFSSPEGVASGQSEQLPYFRDYYSQDDIHPNDKVAVLWAYQPRAADEFELERGD
2de0X           --------TFSSQVCRVAYEIMQTLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGD
2drmA           ---------------------------------------------PGIQVKALYDYDAQTGDELTFKEGD
2b86A           ---------------------------------------------EEVIVIAKWDYTAQQDQELDIKKNE
3eg0A           -------------------------------------------------FVALYDFVASGDNTLSITKGE
1aojA           ------------------------------------------------YAKSKYDFVARNSSELSVMKDD
3c0cA           ------------------------------------------------SCKALYDFEPENDGELGFREGD
2dybB           --------AYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRPRAEALFDFTGNSKLELNFKAGD
2a36A           ------------------------------------------------EAIAKHDFSATADDELSFRKTQ
1ckaA           ------------------------------------------------YVRALFDFNGNDEEDLPFKKGD
2ak5A           --------------------------------------------NSQLVVRAKFNFQQTNEDELSFSKGD
2d1xB           ------------------------------------------------TAVALYDYQAAGDDEISFDPDD
2drkA           ------------------------------------------------QVKALYDYDAQTGDELTFKEGD
2a37A           ------------------------------------------------EAIAKHDFSATADDELSFRKGQ
1b07A           ------------------------------------------------YVRALFDFNGNDEEDLPFKKGD
2bz8B           ------------------------------------------------EAIVEFDYQAQHDDELTISVGE
1awwA           ------------------------------------------------KVVALYDYMPMNANDLQLRKGD
1efnA           -------------------------------------------------FVALYDYEAITEDDLSFHKGE
2a28A           ------------------------------------------------AMEAIYAYEAQGDDEISIDPGD
2csqA           ----------------------GSSGSSGTDPGAEELPARIFVALFDYDPLTMSPNPDAAEEELPFKEGQ
2dbmA           --------------------------------------------SSGPCCRALYDFEPENEGELGFKEGD
3eg2A           ---------------------------------------------DPNLFVALYDFVASGDNTLSITKGE
1avzC           -------------------------------------------------FVALYDYEARTEDDLSFHKGE
1bbzA           -----------------------------------------------NLFVALYDFVASGDNTLSITKGE
1aeyA           ------------------------------------------------LVLALYDYQEKSPREVTMKKGD
2cdtA           -----------------------------------------------ELVLALYDYQEKSPREVTMKKGD
1bu1C           -------------------------------------------------VVALYDYEAIHHEDLSFQKGD
2d0nA           ------------------------------------------------WARALYDFEALEEDELGFRSGE
2dybA           ------------------------------------------------RAEALFDFTGNSKLELNFKAGD
2ct3A           ------------------------------------------------PYRAMYQYRPQNEDELELREGD
2egcA           ------------------------------------------------VYVSIADYEGDE-ETAGFQEGV
2d1xC           --------------------------------------------DLGITAVALYDYQAAGDDEISFDPDD
2ak5B           ------------------------------------------------VVRAKFNFQQTNEDELSFSKGD
2dl4A           --------------------------------------------SSGNTYVALYKFVPQENEDLEMRPGD
2a08A           ------------------------------------------------TAVALYNFAGEQPGDLAFKKGD
1awoA           -------------------------------------------------FVALYDFVASGDNTLSITKGE
2bzyA           ------------------------------------------------KAIQKRVPCAYDKTALALEVGD
2dlmA           ------------------------------------------------AARLKFDFQAQSPKELTLQKGD
1bk2A           -----------------------------------------------ELVLALYDYQEKSPREVTMKKGD
2dxcG           ------------------------------------------------TGIGDPQCFKGMAGKSKFNVGD
1e6hA           ------------------------------------------DETGKELVLVLYDYQEKSPREVTIKKGD
3cqtA           ------------------------------------------------LFEALYDYEARTEDDLSFHKGE
2bz8A           ------------------------------------------------EAIVEFDYQAQHDDELTISVGE


                         .         .         +         .         .         .         .:490
query           MLKVVGIWDDGWATGIRLNETVEDYDGKHKAQRDSGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2de0X           IIGVAGNHWDGYSKGVNR----------------------------------------------------
2drmA           TIIVHQKDPAGWWEGELNGKR-------------------------------------------------
2b86A           RLWLLDDSKTWWRVRNA-----------------------------------------------------
3eg0A           KLRVLGYNHNGEWCEAQTK---------------------------------------------------
1aojA           VLEILDDRRQWWKVRNASGDS-------------------------------------------------
3c0cA           LITLTNQIDENWYEGLH-----------------------------------------------------
2dybB           VIFLLSRINKDW----------------------------------------------------------
2a36A           ILKILNMEDDSNWYRAELD---------------------------------------------------
1ckaA           ILRIRDKPEEQWWNAEDSE---------------------------------------------------
2ak5A           VIHVTRVEEGGWWEGTHNGRT-------------------------------------------------
2d1xB           IITNIEMIDDGWWRGVCKGRY-------------------------------------------------
2drkA           TIIVHQKDPAGWWEGELNGKR-------------------------------------------------
2a37A           ILKILNMEDDSNWYRAELD---------------------------------------------------
1b07A           ILRIRDKPEEQWWNAEDSE---------------------------------------------------
2bz8B           IITNIRKEDGGWWEGQINGRR-------------------------------------------------
1awwA           EYFILEESNLPWWRARDKN---------------------------------------------------
1efnA           KFQILNSSEGDWWEARSL----------------------------------------------------
2a28A           IITVIRGDDGSGWTYGECD---------------------------------------------------
2csqA           IIKVYGDKDADGFYRGETC---------------------------------------------------
2dbmA           IITLTNQIDENWYEGMLHGHSVEILVALPHSGPSSG----------------------------------
3eg2A           KLRVLGYNHNGEWCEAQTK---------------------------------------------------
1avzC           KFQILNSSEGDWWEARSL----------------------------------------------------
1bbzA           KLRVLGYNHNGEWCEAQTK---------------------------------------------------
1aeyA           ILTLLNSTNKDWWKVEVNDRQ-------------------------------------------------
2cdtA           ILTLLNSTNKDWWKVEVNDRQ-------------------------------------------------
1bu1C           QMVVLEESGEWWKARSLAT---------------------------------------------------
2d0nA           VVEVLDSSNPSWWTGRLHNKL-------------------------------------------------
2dybA           VIFLLSRINKDWLEGTV-----------------------------------------------------
2ct3A           RVDVMQQCDDGWFVGVSR----------------------------------------------------
2egcA           SMEVLERNPNGWWYCQILDG--------------------------------------------------
2d1xC           IITNIEMIDDGWWRGVCKGRY-------------------------------------------------
2ak5B           VIHVTRVEEGGWWEGTHNGRT-------------------------------------------------
2dl4A           IITLLEDSNEDWWKGKIQDRI-------------------------------------------------
2a08A           VITILKKSDSQNDWWTGR----------------------------------------------------
1awoA           KLRVLGYNHNGEWCEAQTK---------------------------------------------------
2bzyA           IVKVTRMNINGQWEGEVNGRKVKIFDPQN-----------------------------------------
2dlmA           IVYIHKEVDKNWLEGEHHGRL-------------------------------------------------
1bk2A           ILTLLNSTNKDWWKVEVNGRQ-------------------------------------------------
2dxcG           RVRIKDLPDLFYTRTMTY----------------------------------------------------
1e6hA           ILTLLNSTNKDWWKIEVNDRQ-------------------------------------------------
3cqtA           KFQILNSSEGDWWEARSL----------------------------------------------------
2bz8A           IITNIRKEDGGWWEGQINGRR-------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxx
2de0X           ---------------
2drmA           ---------------
2b86A           ---------------
3eg0A           ---------------
1aojA           ---------------
3c0cA           ---------------
2dybB           ---------------
2a36A           ---------------
1ckaA           ---------------
2ak5A           ---------------
2d1xB           ---------------
2drkA           ---------------
2a37A           ---------------
1b07A           ---------------
2bz8B           ---------------
1awwA           ---------------
1efnA           ---------------
2a28A           ---------------
2csqA           ---------------
2dbmA           ---------------
3eg2A           ---------------
1avzC           ---------------
1bbzA           ---------------
1aeyA           ---------------
2cdtA           ---------------
1bu1C           ---------------
2d0nA           ---------------
2dybA           ---------------
2ct3A           ---------------
2egcA           ---------------
2d1xC           ---------------
2ak5B           ---------------
2dl4A           ---------------
2a08A           ---------------
1awoA           ---------------
2bzyA           ---------------
2dlmA           ---------------
1bk2A           ---------------
2dxcG           ---------------
1e6hA           ---------------
3cqtA           ---------------
2bz8A           ---------------