[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_00742

[Show Plain Result]

#ERROR : Can't open dsspfile "1ci0A.bssp"
#ERROR : Can't open dsspfile "1ci0B.bssp"
#ERROR : Can't open dsspfile "2a2jA.bssp"
#ERROR : Can't open dsspfile "1dnlA.bssp"
#ERROR : Can't open dsspfile "3dmbA.bssp"
#ERROR : Can't open dsspfile "3dmbB.bssp"
#ERROR : Can't open dsspfile "3cp3A.bssp"
#ERROR : Can't open dsspfile "3dmbC.bssp"
#ERROR : Can't open dsspfile "3ec6A.bssp"
#ERROR : Can't open dsspfile "3ba3B.bssp"
#ERROR : Can't open dsspfile "3ba3A.bssp"
#ERROR : Can't open dsspfile "3dnhB.bssp"
#ERROR : Can't open dsspfile "3dnhA.bssp"
#ERROR : Can't open dsspfile "2e83A.bssp"
#ERROR : Can't open dsspfile "2arzA.bssp"
#ERROR : Can't open dsspfile "3db0A.bssp"
#ERROR : Can't open dsspfile "3db0B.bssp"
#ERROR : Can't open dsspfile "2asfA.bssp"
#ERROR : Can't open dsspfile "2arzB.bssp"
#ERROR : Can't open dsspfile "3dmbA.bssp"
#ERROR : Can't open dsspfile "3dmbB.bssp"
#ERROR : Can't open dsspfile "3dmbC.bssp"
#ERROR : Can't open dsspfile "3ec6A.bssp"
#ERROR : Can't open dsspfile "3dnhB.bssp"

## Summary of PDB Search
:241
    9e-27  52%  1ci0A  [b.45.1] PROTEIN (PNP OXIDASE)
    2e-26  50%  1ci0B  [b.45.1] PROTEIN (PNP OXIDASE)
    3e-23  45%  2a2jA  [x.x.x] PYRIDOXAMINE 5'-PHOSPHATE OXIDASE
    5e-20  44%  1dnlA  [b.45.1] PYRIDOXINE 5'-PHOSPHATE OXIDASE
    3e-10  14%  3dmbA  [x.x.x] PUTATIVE GENERAL STRESS PROTEIN 26 WITH A PNP-
    5e-10  21%  3dmbB  [x.x.x] PUTATIVE GENERAL STRESS PROTEIN 26 WITH A PNP-
    1e-08   7%  3cp3A  [x.x.x] UNCHARACTERIZED PROTEIN
    1e-07  14%  3dmbC  [x.x.x] PUTATIVE GENERAL STRESS PROTEIN 26 WITH A PNP-
    2e-07  14%  3ec6A  [x.x.x] GENERAL STRESS PROTEIN 26
    4e-07  13%  3ba3B  [x.x.x] PYRIDOXAMINE 5'-PHOSPHATE OXIDASE-LIKE PROTEIN
    5e-07  13%  3ba3A  [x.x.x] PYRIDOXAMINE 5'-PHOSPHATE OXIDASE-LIKE PROTEIN
    1e-06  19%  3dnhB  [x.x.x] UNCHARACTERIZED PROTEIN ATU2129
    1e-05   8%  3dnhA  [x.x.x] UNCHARACTERIZED PROTEIN ATU2129
    3e-05  14%  2e83A  [x.x.x] FMN-BINDING PROTEIN
    2e-04  12%  2arzA  [x.x.x] HYPOTHETICAL PROTEIN PA4388
    2e-04  13%  3db0A  [x.x.x] LIN2891 PROTEIN
    3e-04  11%  3db0B  [x.x.x] LIN2891 PROTEIN
    4e-04  17%  2asfA  [x.x.x] HYPOTHETICAL PROTEIN RV2074
    7e-04  17%  2arzB  [x.x.x] HYPOTHETICAL PROTEIN PA4388
    4e-06  15%  3dmbA  [x.x.x] PUTATIVE GENERAL STRESS PROTEIN 26 WITH A PNP-(query 70->151)
    8e-06  12%  3dmbB  [x.x.x] PUTATIVE GENERAL STRESS PROTEIN 26 WITH A PNP-(query 68->149)
    1e-07  21%  3dmbC  [x.x.x] PUTATIVE GENERAL STRESS PROTEIN 26 WITH A PNP-(query 177->216)
    9e-05  19%  3ec6A  [x.x.x] GENERAL STRESS PROTEIN 26(query 70->148)
    5e-04  11%  3dnhB  [x.x.x] UNCHARACTERIZED PROTEIN ATU2129(query 82->153)
:241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xPSGRVSARIVYLKELDERGWVVYSNWGSRAGKGGQVFGTETGIDVNXXXXXXXXXXXXSVIPDDGQGKL
1ci0A           -PSGRVSSRILLFKELDHRGFTIYSNW-GTSRKAHD---------------------------------I
1ci0B           ---------------------------------------------------------------------I
2a2jA           -ADGKPVTRSVLCKILDESGVAFFTSYTSAKGEQ-----------------------------------L
1dnlA           ---------------------------------------------------------------------I
3dmbA           ----------------------------------------------------------------------
3dmbB           ----------------------------------------------------------------------
3cp3A           ---DDLDIFPVNFVLDYSAEQPRVYFRTATKLFS-----------------------------------V
3dmbC           -DRTVLGARPTAQIEGDSGGPIWFFTS-----------------------------------KDNALIAL
3ec6A           ----------------------------------------------------------------------
3ba3B           ---NEADVKIVNFVWYEAQPDTLYFSSVKTSPALKV---------------------------------Y
3ba3A           ---NEADVKIVNFVWYEAQPDTLYFSSVKTSPALKV---------------------------------Y
3dnhB           ----------------------------------------------------------------------
3dnhA           -VSGYPYTTATNIGIEPDGTPFFFAAGLTLHARN-----------------------------------E
2e83A           -----VNVWNSYLKVLDGNRIVVPVGGMHKTEAN-----------------------------------V
2arzA           -WPGFPFGSVVPYCLDAEGRPLILISRIAQHTHN-----------------------------------L
3db0A           ---------------------------------------------------------------------V
3db0B           ---------------------------------------------------------------------V
2asfA           -ADNSPHVVAVFTFDPKTHIARVITTGGSQKAVN-----------------------------------A
2arzB           -WPGFPFGSVVPYCLDAEGRPLILISRIAQHTHN-----------------------------------L
3dmbA           ---------------------------------------------------------------------L
3dmbB           -------------------------------------------------------------------IAL
3dmbC           ----------------------------------------------------------------------
3ec6A           ---------------------------------------------------------------------I
3dnhB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EGNRWAALTFNWPSVERQVRVEGLIEMLSREESETYWRVRERGSQIGAWASQQSKVLWSTEPRDMEGVDA
1ci0A           ATNPNAAIVFFWKDLQRQVRVEGITEHVNRETSERYFKTRPRGSKIGAWASRQSDVI-------------
1ci0B           ATNPNAAIVFFWKDLQRQVRVEGITEHVNRETSERYFKTRPRGSKIGAWASRQSDVIKNRE---------
2a2jA           AVTPYASATFPWYQLGRQAHVQGPVSKVSTEEIFTYWSMRPRGAQLGAWASQQSRPV-------------
1dnlA           ENNPRVSLLFPWHTLERQVVIGKAERL--STLEVKYFHSRPRDSQIGAWVSKQSS---------------
3dmbA           ----------------------------------------------------------------------
3dmbB           ----------------------------------------------------------------------
3cp3A           NLNSDVLFEVDRFDEGWSVVLKGNAYVVRDTEEARHADTLGLKPWLPT----LKYNFVRIDVREVSG---
3dmbC           GQGRRVIGAFSSKGHDLFASISGSLREDDPAVVDRLWNPY-----VAAWYEGGKDALLRLDADHAQIWLN
3ec6A           ----------------------------------------------------------------------
3ba3B           DQNPDIAFITIPNPYLRAQHVKLQRSTKTTDLLPQYLETVPNYQQVWDAIGSTL-VVFELKLTDLFVDAG
3ba3A           DQNPDIAFITIPNDYLRAQHVKLQRSTKTTDLLPQYLETVPNYQQVWDAIGSTL-VVFELKLTDLFVDAG
3dnhB           ----------------------------------------------------------------------
3dnhA           TDARISVTLAPDALTLPRLTLVGRADRIGPDEVPLAARYIARYPKAKLYLSLPDTRLYRLRTEGVQINGS
2e83A           ARDERVLMTLGSRKVGTGFLIRGSAAFRTDGPEFEAIARFKWARAA------------------------
2arzA           QADPRCSMLVERGAEDIQAVGRLTLRQLAEEEAERYYRYFP---ESADYHRVHDFDFWVLQPVQWRFIGG
3db0A           RRNPHVCVLIGYDSPSAFLEINGLASLEDESIKERIWENI-----SKDWFQFVVIKIVPEQIRIL-----
3db0B           RRNPHVCVLIGYDSPSAFLEINGLASLEEDESIKERIW-ENISKDWFQGEDSPSFVVIKIVPEQIRILNS
2asfA           DRSGLAVLSQVDG--ARWLSLEGRAAVNSDIDAELRYAQRYRTPR-------------------------
2arzB           QADPRCSMLVGEA--VGRLTLLAEARQLAEEEAERYYRYFPESAD---YHRVHDFDFWVLQPVQWRFIGI
3dmbA           GQGRRVIGAFSSKGHDLFASISGSLREDTPAVVDRLWN-----PYVAAWYEGGKDALLRLDADHAQIWL-
3dmbB           GQGRRVIGAFSSKGHDLFASISGSLREDTDPA----VVDRLWNPYVAAWYEGGKDALLRLDADHAQIWLN
3dmbC           ----------------------------------------------------------------------
3ec6A           ENNPNVHVLLGRKLDEDYIEVEGLASIEEDSTLKNKFWNN----SLKRWLLRPNYVLIKINPDTIYYID-
3dnhB           -----------DALTLPRLTLVGRADRIGPDEVPLAARYIARYPKAKLYLSLPDTRLYRLRTEGVQ-ING


                         +         .         .         .         .         *         .:210
query           VPGAASRLKDINSQSGEEDDGRSVLENRVKEMEKRFADTEEIPLPPFWGGVRLVPESVEFWQGRKSRLHD
1ci0A           -------------------KNREELDELTQKNTERFKDAEDIPCPDYWGGLRIVPLEIEFWQGRPSRLHD
1ci0B           -----------------------ELDELTQKNTERFKDAEDIPCPDYWGGLRIVPLEIEFWQGRPSRLHD
2a2jA           -------------------GSRAQLDNQLAEVTRRFADQDQIPVPPGWGGYRIAPEIVEFWQGRENRMHN
1dnlA           -----------------RISARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
3dmbA           -------------------SGSLREDTDPAVVDRLWNPYEGGKDDPKLALLRLDADHAQIWLNGSSLLAG
3dmbB           ------------------------------------AWYEGGKDDPKLALLRLDADHAQIWLNGSSLLAG
3cp3A           ----------------------------------------------------------------------
3dmbC           GSSLLAGIK-------------------------------------------------------------
3ec6A           -------------------------------WNNSLKRWLLRPEDPNYVLIKINPDTIYYIDPEFLRL--
3ba3B           VGGEKQTL--------------------------------------------------------------
3ba3A           VGGEKQTL--------------------------------------------------------------
3dnhB           ---------------------------------ARYPKAKLYLSLPDTRLYRLRTEGVQINITPADLRTD
3dnhA           N-ITPADL------RTDLSGAEAAAESEATRLNAIKGE--------------------------------
2e83A           ----------------------------------------------------------------------
2arzA           FGAILAAERVPLANPFAGEAERGMVE--------------------------------------------
3db0A           ----------------------------------------------------------------------
3db0B           ----------------------------------------------------------------------
2asfA           ----------------------------------------------------------------------
2arzB           HWLAAERVPLANPFAGEAERG------MVEHMNSDHAA--------------------------------
3dmbA           --NGSSLLAGI-----------------------------------------------------------
3dmbB           GSSLLAGIK-------------------------------------------------------------
3dmbC           ------------------------------------AWYEGGKDDPKLALLRLDADHAQIWLNG-SSLLA
3ec6A           --PEFLRL--------------------------------------------------------------
3dnhB           NITPADLRTDLSG---------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RFRYVRVHGENEHLGEGDEKTFRWRIQRLSP
1ci0A           RFVYRRKTENDP-----------WKVVRLAP
1ci0B           RFVYRRKTENDP-----------WKVVRLAP
2a2jA           RIRVA-----------------NGRLERLQP
1dnlA           RFLYQRENDA-------------WKIDRLAP
3dmbA           IKVLL--------------------------
3dmbB           IKVLL--------------------------
3cp3A           -------------------------------
3dmbC           -------------------------------
3ec6A           -------------------------------
3ba3B           -------------------------------
3ba3A           -------------------------------
3dnhB           -------------------------------
3dnhA           -------------------------------
2e83A           -------------------------------
2arzA           -------------------------------
3db0A           -------------------------------
3db0B           -------------------------------
2asfA           -------------------------------
2arzB           -------------------------------
3dmbA           -------------------------------
3dmbB           -------------------------------
3dmbC           GIKVLL-------------------------
3ec6A           -------------------------------
3dnhB           -------------------------------