[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_00779

[Show Plain Result]

#ERROR : Can't open dsspfile "2bkuB.bssp"
#ERROR : Can't open dsspfile "2db0A.bssp"
#ERROR : Can't open dsspfile "1b3uA.bssp"
#ERROR : Can't open dsspfile "3ea5D.bssp"
#ERROR : Can't open dsspfile "1ee5A.bssp"
#ERROR : Can't open dsspfile "3ea5B.bssp"
#ERROR : Can't open dsspfile "2bptA.bssp"
#ERROR : Can't open dsspfile "1ejlI.bssp"
#ERROR : Can't open dsspfile "1bk6A.bssp"
#ERROR : Can't open dsspfile "2bkuD.bssp"
#ERROR : Can't open dsspfile "3bctA.bssp"
#ERROR : Can't open dsspfile "2c1mA.bssp"
#ERROR : Can't open dsspfile "2db0B.bssp"
#ERROR : Can't open dsspfile "3c2gA.bssp"

## Summary of PDB Search
:1773
    8e-09  11%  2bkuB  [x.x.x] IMPORTIN BETA-1 SUBUNIT
    2e-08  12%  2db0A  [x.x.x] 253AA LONG HYPOTHETICAL PROTEIN
    6e-08  10%  1b3uA  [a.118.1] PROTEIN (PROTEIN PHOSPHATASE PP2A)
    1e-07   9%  3ea5D  [x.x.x] IMPORTIN SUBUNIT BETA-1
    1e-07  13%  1ee5A  [a.118.1] KARYOPHERIN ALPHA
    8e-07  11%  3ea5B  [x.x.x] IMPORTIN SUBUNIT BETA-1
    1e-06   9%  2bptA  [x.x.x] IMPORTIN BETA-1 SUBUNIT
    1e-06  11%  1ejlI  [a.118.1] IMPORTIN ALPHA
    2e-06  14%  1bk6A  [a.118.1] KARYOPHERIN ALPHA
    2e-06   8%  2bkuD  [x.x.x] IMPORTIN BETA-1 SUBUNIT
    3e-05  11%  3bctA  [x.x.x] BETA-CATENIN
    6e-05  10%  2c1mA  [x.x.x] IMPORTIN-ALPHA2 SUBUNIT
    2e-04  15%  2db0B  [x.x.x] 253AA LONG HYPOTHETICAL PROTEIN
    8e-04  10%  3c2gA  [x.x.x] SYS-1 PROTEIN
:1773

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
3ea5D           ----------------------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ----------------------------------------------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
3ea5D           ----------------------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ----------------------------------------------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
3ea5D           ----------------------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ----------------------------------------------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
3ea5D           ----------------------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ----------------------------------------------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
3ea5D           ----------------------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ----------------------------------------------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
3ea5D           ----------------------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ----------------------------------------------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
3ea5D           ----------------------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ----------------------------------------------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
3ea5D           ----------------------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ----------------------------------------------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
3ea5D           ----------------------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ----------------------------------------------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTEDLISVLGSTDWPGAELILRVLASQMITIADHDKSSAN
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
3ea5D           ----------------------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ----------------------------------------------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           -------------------------------TFDLLGLLLHDSDAIDGFVRSDGVGAITTVVQYP--NND


                         .         .         .         .         +         .         .:770
query           AKNMSLELLGWMGSAISDLTSTAQHLSNTLEDGHTDLTDHLRNLFHDYSNRALHIQDIVSLDGPYRMTLE
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
3ea5D           ----------------------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ----------------------------------------------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           LIRAGCKLLLQVSDAKALENILPFLLRLIEIHPDDEVIYSGTGFLSNVVAHKQHVKDIAIRSNAIFLLHT


                         .         .         *         .         .         .         .:840
query           YLEEGDLGSWQLSSARGYLIAQWAKLVCSGYEDSAQGGSTKNPQGAGKLAKALSHILSNPKWLESNSAFD
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
3ea5D           ----------------------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ------------------------------------------------------QNITADNWRNREAAVM
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------GQMAKEKPELVKSMIPVLFANYRI
3c2gA           IISKYPRLDELTDAPKRNRVCEIICNCLRTLNNFLWIPTP-----------NGETKTAGPNEKQQVCKFI


                         +         .         .         .         .         *         .:910
query           RISTQQARFAYLIIVLSSGFCKGFDTIVKVLLNSITSDQAKVRSRSLKSVIHMLERDPSLLDRDGSVISL
2bkuB           ------------------------------------------------------------------FAQL
2db0A           ---------AKAFGQMAKEKPELVKSMIPVLFANYRIGDEKTKINVSYALEEIAKANPMLMAS---IVRD
1b3uA           ------------------------------------------------------AADGDDSLY---PIAV
3ea5D           ------------------------------------------------------------------FAQL
1ee5A           ------------------------------MTQQLNSDDMQEQLSATVKFRQILSREHRVVIQAGVVPRL
3ea5B           ------------------------------------------------------------------FAQL
2bptA           ------------------------------------------------------------------FAQL
1ejlI           --------------------------SVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDAGLIPKF
1bk6A           ---------------------------LPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVGVVPRL
2bkuD           AFGSIMDGPDKVQ------RTYYVHQALPSILNLMNDQSLQVKETTAWCIGRIADSVAESIDPQPGVVQA
3bctA           -------------------------------------------------------------------VSA
2c1mA           ------------------------NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDAGLIPKF
2db0B           GDEKTKINVSYALEEIAKANPMLMASIVRDFMSMLSSKNREDKLTALNFIEAMGENSFKYVNPF---LPR
3c2gA           EIDILKKLSCLSCED-TPGLLELRSTILRSFILLLRTPFVPKDGVLNVIDENRKENLIGHICASWVFRQP


                         .         .         .         +         .         .         .:980
query           ILRCATDSSPMVRDSALSLIAKCMFLKPGLEENCCRAILACSSDPTVGVRKRAIGLMKDVYIQTSNQELK
2bkuB           LENSILSPDQNIRLTSETQLKK-LSNDNFLQFAGLSSQVLIDENTKLEGRILAALTLKNELVSKDSVKTQ
2db0A           FMSMLSSKNREDKLTALNFIEAMGENSFKYVNPFLPRIINLLHDGDEIVRASAVEALVHLATLNDKLR--
1b3uA           LIDELRNEDVQLRLNSIKKLSTIAALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYV
3ea5D           LENSILSPDQNIRLTSETQLKK-LSNDNFLQFAGLSSQVLIDENTKLEGRILAALTLKNELVSKDSVKTQ
1ee5A           VEFMRENQPEMLQLEAAWALTNIAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDY
3ea5B           LENSILSPDQNIRLTSETQLKK-LSNDNFLQFAGLSSQVLIDENTKLEGRILAALTLKNELVSKDSVKTQ
2bptA           LENSILSPDQNIRLTSETQLKK-LSNDNFLQFAGLSSQVLIDENTKLEGRILAALTLKNELVSKDSVKTQ
1ejlI           VSFLGKTDCSPIQFESAWALTNIASGTSEVDGGAIPAFISLLASPHAHISEQAVWALG--NIAGDGSAFR
1bk6A           VEFMRENQPEMLQLEAAWALTNIAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDY
2bkuD           CLIGLQDHPKVATNCSWTIINLVEQIYNFYPALVDGLIGAANRDNEFNARASAFTDTVAETSASISTFVM
3bctA           IVRTQNTNDVETARCTAGTLHNLSHHREGFKSGGIPALVKLGSPVDSVLFYAITTLHNLLLHQEGAKAVR
2c1mA           VSFLGKTDCSPIQFESAWALTNIAQTKAVVDGGAIPAFISLLASPHAHISEQAVWALG--NIAGDGSAFR
2db0B           IINLLHDGDEIVRASAVEALVHLATLNDKLRK-VVIKRLEELNDTSSLVNKTVK----------------
3c2gA           NNTRTQSTKQQLVERTISLLLVLEQCGAEKESYSIDCPLNLLNGNQVKPTFIHNVLVVCDKILEHCPTRI


                         .         *         .         .         .         .         +:1050
query           LTIIEQLLLRVTDYESSVAVQASQALEEIWFSPLHSSFTESTQGTPQSKVSLKNLMNLIVGSVRRNEGVI
2bkuB           QFAQRWITQVSPEAKNQIKTNALTALVSI-----------------------------------------
2db0A           -KVVIKRLEELNDTSSLVNKTVKEGISRL-----------------------------------------
1b3uA           HCLLPPLESLATVEETVVRDKAVESLRAISFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELR
3ea5D           QFAQRWITQVSPEAKNQIKTNALTALVSIE-----PRIANAAAQLIAAIADIELPHGAWPELMKIMVDNT
1ee5A           VLAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKL------------------
3ea5B           QFAQRWITQVSPEAKNQIKTNALTALVSI-----------------------------------------
2bptA           QFAQRWITQVSPEAKNQIKTNALTALVSIEAAQLIAAIADIELPHGAWPELMKIMVDNTGAEQPENVKRA
1ejlI           DLVIKHGLLAVPDLSTLACGYLRNLTWTLS----------------------------------------
1bk6A           VNAMEPILGLFNSNKPSLIRTATWTLSNLC----------------------------------------
2bkuD           DKLGQTMSVEDAQSLQELQSNILTVLAAVIRKSPSSVEPVADMLMGLFFRLLEKKDS-------------
3bctA           LAGGLQKVALLNKTNVKFLAITTDCLQILA----------------------------------------
2c1mA           DLVIKHGAI-------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           WTIDRPLEGLTNHRNSDIAKAANSLLSRF-----------------------------------------


                         .         .         .         .         *         .         .:1120
query           ATFEAFVKDELSAEAKSASLNFNVCKAVVAAMFDRIIHDSDKTDKRTLQSLLQSITVFARANAKLFTPDQ
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           QYFRNLCSDDTPMVRRAAASKLNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPT
3ea5D           GAEQPENVKRASLL--ALGYMCESANILIAIVQGAQSTETSKAVRLAALNALADSLIFIKNNMER--EGE
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           SLLALGYMCESADPQSQALVSSSNNILIAIVQGAQSTETSKAVRLAALNALAD---SLIFIKNNMEREGE
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ---AFIEDDVFYAISALAASLGKGFEKYLETFSPYLLKALNQVDSPVSITAVGFIADISNSLEEDFRRYS
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           LETLHPYIGHLSNADDLMLFRSVVVIYRCVLPYLSTSHNTLLKDIQNDLFKSVSKLARTELNEVMACLWT
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           LRQAAEDFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPC
3ea5D           RNYLMQVVCEATQAEDIEVQAAAF---GCLCKIMSKYYTFMKPYMEQALYALTIATMKSPNDKVSMTVEF
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           RNYLMQVVCEATQAEDIEVQAAAFGCLCKIMTFMKPYMEQALYALTIATMKSPNDKVASMTVEFWSTICE
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           DAMMNVLAQMINPNARRELKPAVLSVFGDIASNIGADFIPYLNDIMALCVAAQNNGTLEALDYQIKVLEA
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           INGVLQNTERLVKLTISVLKGINQAVSAKVDPSTSADVLGRVRSYIRIAGCVGKHCDLESFLAFFSQSFP
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           IKELVSDANQHVKS--ALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGI
3ea5D           WSTICEEEIDIAYE-LAQFPQSPLQSYNFALSSIKDVVPNLLNLLTRQNEDPE---DDDWNVSMSAGACL
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           EEILAQFPQSPLQSYNFALSSIKDVVPNLLNLLTRQNEDEDDDWNVSMSAG-------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           VLDAYVGIVAGLHDKPEALFPYVGTIFQFIAQVAE-DPQLYSEDATSAVGLIGDIAAMFP-----DGSIK
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           HMKATSVSGLMVDFISPFASSKYPHELRVMALESLGAICETWPAQYSREPAKIAFTSVFEEDSPDLQNIV
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           RQLSQSLLPAIVEL-----AEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAA
3ea5D           QLFAQNCGNHILEPVLEFVEQNITARNREAAVMAFGSIMDGPDKVQRTYYVHQALPSILNLMNDQSLQVK
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           QFYGQDWVIDYIKRTRSGQLFS--QATKDTARWAREQQKR------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           LKGFLAFFSIHExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           TSNLKKLVEKF-----------------------------------------------------------
3ea5D           ETTAWCIGRIAD----------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ----------------------------------------------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
3ea5D           ----------------------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ----------------------------------------------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
3ea5D           ----------------------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ----------------------------------------------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
3ea5D           ----------------------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ----------------------------------------------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:1680
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
3ea5D           ----------------------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ----------------------------------------------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1750
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuB           ----------------------------------------------------------------------
2db0A           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
3ea5D           ----------------------------------------------------------------------
1ee5A           ----------------------------------------------------------------------
3ea5B           ----------------------------------------------------------------------
2bptA           ----------------------------------------------------------------------
1ejlI           ----------------------------------------------------------------------
1bk6A           ----------------------------------------------------------------------
2bkuD           ----------------------------------------------------------------------
3bctA           ----------------------------------------------------------------------
2c1mA           ----------------------------------------------------------------------
2db0B           ----------------------------------------------------------------------
3c2gA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1820
query           xxxxxxxxxxxxxxxxxxxxxxx
2bkuB           -----------------------
2db0A           -----------------------
1b3uA           -----------------------
3ea5D           -----------------------
1ee5A           -----------------------
3ea5B           -----------------------
2bptA           -----------------------
1ejlI           -----------------------
1bk6A           -----------------------
2bkuD           -----------------------
3bctA           -----------------------
2c1mA           -----------------------
2db0B           -----------------------
3c2gA           -----------------------