[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_00781

[Show Plain Result]

#ERROR : Can't open dsspfile "2bkuD.bssp"

## Summary of PDB Search
:335
    6e-04  11%  2bkuD  [x.x.x] IMPORTIN BETA-1 SUBUNIT
:335

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkuD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxAIEALAEGFKDRSALFRHEIAFVFGQLSHPASIPSLVATLSDKNEVGMVRHXXXX
2bkuD           ---------------FAQLLENSILSPDQNIRLTSETQLKKLSNDNFLQFAGLVLIDENTKLEGRINELV


                         .         *         .         .         .         .         +:350
query           XXXXXXXXDGVEETLKRFVNDPETVVRDSIIVALxxxxxxxxxxxxxxxxxxxxx
2bkuD           SKDSVKTQQFAQRWITQVSPEAKNQIKTNALTAL---------------------