[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_01225

[Show Plain Result]

#ERROR : Can't open dsspfile "1cvjF.bssp"
#ERROR : Can't open dsspfile "1cvjD.bssp"
#ERROR : Can't open dsspfile "1cvjC.bssp"
#ERROR : Can't open dsspfile "1cvjA.bssp"
#ERROR : Can't open dsspfile "2dhxA.bssp"
#ERROR : Can't open dsspfile "2adcA.bssp"
#ERROR : Can't open dsspfile "3bs9A.bssp"
#ERROR : Can't open dsspfile "1cvjG.bssp"
#ERROR : Can't open dsspfile "3d45B.bssp"
#ERROR : Can't open dsspfile "1b7fA.bssp"
#ERROR : Can't open dsspfile "2dgqA.bssp"
#ERROR : Can't open dsspfile "3dedA.bssp"
#ERROR : Can't open dsspfile "2dgoA.bssp"
#ERROR : Can't open dsspfile "1drzA.bssp"
#ERROR : Can't open dsspfile "1cx0A.bssp"
#ERROR : Can't open dsspfile "2ek6A.bssp"
#ERROR : Can't open dsspfile "2dgpA.bssp"
#ERROR : Can't open dsspfile "2cqbA.bssp"
#ERROR : Can't open dsspfile "2dgxA.bssp"
#ERROR : Can't open dsspfile "3culA.bssp"
#ERROR : Can't open dsspfile "3cunA.bssp"
#ERROR : Can't open dsspfile "1cvjB.bssp"
#ERROR : Can't open dsspfile "1d8zA.bssp"
#ERROR : Can't open dsspfile "2dh7A.bssp"
#ERROR : Can't open dsspfile "1a9nD.bssp"
#ERROR : Can't open dsspfile "2e5hA.bssp"
#ERROR : Can't open dsspfile "1audA.bssp"
#ERROR : Can't open dsspfile "3d45A.bssp"
#ERROR : Can't open dsspfile "2cpzA.bssp"
#ERROR : Can't open dsspfile "2cqcA.bssp"
#ERROR : Can't open dsspfile "1d9aA.bssp"
#ERROR : Can't open dsspfile "3b4dA.bssp"
#ERROR : Can't open dsspfile "3begB.bssp"
#ERROR : Can't open dsspfile "3efxJ.bssp"
#ERROR : Can't open dsspfile "2dnyA.bssp"
#ERROR : Can't open dsspfile "2ek1A.bssp"
#ERROR : Can't open dsspfile "2dh8A.bssp"
#ERROR : Can't open dsspfile "2dk2A.bssp"
#ERROR : Can't open dsspfile "2db1A.bssp"
#ERROR : Can't open dsspfile "2cq0A.bssp"
#ERROR : Can't open dsspfile "3ctrA.bssp"
#ERROR : Can't open dsspfile "2a3jA.bssp"
#ERROR : Can't open dsspfile "3b4mD.bssp"
#ERROR : Can't open dsspfile "2cpfA.bssp"
#ERROR : Can't open dsspfile "3egnA.bssp"
#ERROR : Can't open dsspfile "2cjkA.bssp"
#ERROR : Can't open dsspfile "2adbA.bssp"
#ERROR : Can't open dsspfile "2cqpA.bssp"
#ERROR : Can't open dsspfile "2dnzA.bssp"
#ERROR : Can't open dsspfile "2dgsA.bssp"
#ERROR : Can't open dsspfile "1a9nB.bssp"
#ERROR : Can't open dsspfile "3dedC.bssp"
#ERROR : Can't open dsspfile "2cqdA.bssp"
#ERROR : Can't open dsspfile "2ek1D.bssp"
#ERROR : Can't open dsspfile "2bz2A.bssp"
#ERROR : Can't open dsspfile "2dgvA.bssp"
#ERROR : Can't open dsspfile "2cpxA.bssp"
#ERROR : Can't open dsspfile "2cq3A.bssp"
#ERROR : Can't open dsspfile "2dh9A.bssp"
#ERROR : Can't open dsspfile "2dnkA.bssp"
#ERROR : Can't open dsspfile "2dhsA.bssp"
#ERROR : Can't open dsspfile "2dnqA.bssp"
#ERROR : Can't open dsspfile "2do4A.bssp"
#ERROR : Can't open dsspfile "2dhgA.bssp"
#ERROR : Can't open dsspfile "2dnpA.bssp"
#ERROR : Can't open dsspfile "2dnmA.bssp"
#ERROR : Can't open dsspfile "2cqgA.bssp"
#ERROR : Can't open dsspfile "2ek1B.bssp"
#ERROR : Can't open dsspfile "2e5jA.bssp"
#ERROR : Can't open dsspfile "1cvjH.bssp"
#ERROR : Can't open dsspfile "2cpiA.bssp"
#ERROR : Can't open dsspfile "2e44A.bssp"
#ERROR : Can't open dsspfile "2disA.bssp"
#ERROR : Can't open dsspfile "3dxbA.bssp"
#ERROR : Can't open dsspfile "2dhaA.bssp"
#ERROR : Can't open dsspfile "2dngA.bssp"
#ERROR : Can't open dsspfile "2cq4A.bssp"
#ERROR : Can't open dsspfile "2diuA.bssp"
#ERROR : Can't open dsspfile "2divA.bssp"
#ERROR : Can't open dsspfile "2cqiA.bssp"
#ERROR : Can't open dsspfile "2dnnA.bssp"
#ERROR : Can't open dsspfile "2ek1G.bssp"
#ERROR : Can't open dsspfile "2d9pA.bssp"
#ERROR : Can't open dsspfile "2cpyA.bssp"
#ERROR : Can't open dsspfile "2dnlA.bssp"
#ERROR : Can't open dsspfile "2cphA.bssp"
#ERROR : Can't open dsspfile "2e5iA.bssp"
#ERROR : Can't open dsspfile "2dgtA.bssp"
#ERROR : Can't open dsspfile "2dnhA.bssp"
#ERROR : Can't open dsspfile "2aymA.bssp"
#ERROR : Can't open dsspfile "2dnoA.bssp"
#ERROR : Can't open dsspfile "3dxbE.bssp"
#ERROR : Can't open dsspfile "2cpeA.bssp"
#ERROR : Can't open dsspfile "2cpjA.bssp"
#ERROR : Can't open dsspfile "2ditA.bssp"
#ERROR : Can't open dsspfile "2cpdA.bssp"
#ERROR : Can't open dsspfile "2do0A.bssp"
#ERROR : Can't open dsspfile "2e5gA.bssp"
#ERROR : Can't open dsspfile "2dgwA.bssp"
#ERROR : Can't open dsspfile "3d2wA.bssp"
#ERROR : Can't open dsspfile "2dguA.bssp"
#ERROR : Can't open dsspfile "2dnrA.bssp"
#ERROR : Can't open dsspfile "2ad9A.bssp"
#ERROR : Can't open dsspfile "2cqhA.bssp"
#ERROR : Can't open dsspfile "2cq1A.bssp"
#ERROR : Can't open dsspfile "2cq2A.bssp"
#ERROR : Can't open dsspfile "2d9oA.bssp"

## Summary of PDB Search
:252
    5e-17  32%  1cvjF  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    2e-14  33%  1cvjD  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    2e-14  32%  1cvjC  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    3e-14  33%  1cvjA  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    3e-14  18%  2dhxA  [x.x.x] POLY (ADP-RIBOSE) POLYMERASE FAMILY, MEMBER 10
    4e-14  25%  2adcA  [x.x.x] POLYPYRIMIDINE TRACT-BINDING PROTEIN 1
    4e-14  38%  3bs9A  [x.x.x] NUCLEOLYSIN TIA-1 ISOFORM P40
    2e-13  33%  1cvjG  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    4e-13  18%  3d45B  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    4e-13  27%  1b7fA  [d.58.7 - d.58.7] PROTEIN (SXL-LETHAL PROTEIN)
    6e-13  20%  2dgqA  [x.x.x] BRUNO-LIKE 6, RNA BINDING PROTEIN
    8e-13  12%  3dedA  [x.x.x] PROBABLE HEMOLYSIN
    2e-12  37%  2dgoA  [x.x.x] CYTOTOXIC GRANULE-ASSOCIATED RNA BINDING PROTEIN
    2e-12  15%  1drzA  [d.58.7] PROTEIN (U1 SMALL RIBONUCLEOPROTEIN A)
    2e-12  15%  1cx0A  [d.58.7] U1A PROTEIN
    2e-12  19%  2ek6A  [x.x.x] RNA-BINDING PROTEIN 12
    5e-12  21%  2dgpA  [x.x.x] BRUNO-LIKE 4, RNA BINDING PROTEIN
    5e-12  28%  2cqbA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE E
    5e-12  12%  2dgxA  [x.x.x] KIAA0430 PROTEIN
    5e-12  16%  3culA  [x.x.x] U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
    5e-12  16%  3cunA  [x.x.x] U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
    7e-12  35%  1cvjB  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    1e-11  28%  1d8zA  [d.58.7] HU ANTIGEN C
    1e-11  37%  2dh7A  [x.x.x] NUCLEOLYSIN TIAR
    1e-11  21%  1a9nD  [d.58.7] SPLICEOSOMAL U2B''
    1e-11  30%  2e5hA  [x.x.x] ZINC FINGER CCHC-TYPE AND RNA-BINDING MOTIF-
    2e-11  23%  1audA  [d.58.7] U1A 102
    2e-11  12%  3d45A  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    2e-11  32%  2cpzA  [x.x.x] CUG TRIPLET REPEAT RNA-BINDING PROTEIN 1
    2e-11  21%  2cqcA  [x.x.x] ARGININE/SERINE-RICH SPLICING FACTOR 10
    2e-11  20%  1d9aA  [d.58.7] HU ANTIGEN C
    2e-11  21%  3b4dA  [x.x.x] POLYADENYLATE-BINDING PROTEIN 2
    3e-11  19%  3begB  [x.x.x] SPLICING FACTOR, ARGININE/SERINE-RICH 1
    5e-11   9%  3efxJ  [x.x.x] CHOLERA ENTEROTOXIN SUBUNIT B, HEAT-LABILE
    6e-11  12%  2dnyA  [x.x.x] FUSE-BINDING PROTEIN-INTERACTING REPRESSOR,
    6e-11  23%  2ek1A  [x.x.x] RNA-BINDING PROTEIN 12
    7e-11  27%  2dh8A  [x.x.x] DAZ-ASSOCIATED PROTEIN 1
    1e-10  35%  2dk2A  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN R
    1e-10  12%  2db1A  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN F
    1e-10  25%  2cq0A  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 3
    1e-10  11%  3ctrA  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    1e-10  16%  2a3jA  [x.x.x] U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
    2e-10  22%  3b4mD  [x.x.x] POLYADENYLATE-BINDING PROTEIN 2
    2e-10  26%  2cpfA  [x.x.x] RNA BINDING MOTIF PROTEIN 19
    2e-10  20%  3egnA  [x.x.x] RNA-BINDING PROTEIN 40
    2e-10  26%  2cjkA  [x.x.x] NUCLEAR POLYADENYLATED RNA-BINDING PROTEIN 4
    2e-10  21%  2adbA  [x.x.x] POLYPYRIMIDINE TRACT-BINDING PROTEIN 1
    3e-10  20%  2cqpA  [x.x.x] RNA-BINDING PROTEIN 12
    6e-10  31%  2dnzA  [x.x.x] PROBABLE RNA-BINDING PROTEIN 23
    6e-10  25%  2dgsA  [x.x.x] DAZ-ASSOCIATED PROTEIN 1
    6e-10  20%  1a9nB  [d.58.7] SPLICEOSOMAL U2B''
    8e-10   6%  3dedC  [x.x.x] PROBABLE HEMOLYSIN
    1e-09  33%  2cqdA  [x.x.x] RNA-BINDING REGION CONTAINING PROTEIN 1
    1e-09  24%  2ek1D  [x.x.x] RNA-BINDING PROTEIN 12
    2e-09  22%  2bz2A  [x.x.x] NEGATIVE ELONGATION FACTOR E
    2e-09  27%  2dgvA  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN M
    2e-09  17%  2cpxA  [x.x.x] HYPOTHETICAL PROTEIN FLJ11016
    3e-09  26%  2cq3A  [x.x.x] RNA-BINDING PROTEIN 9
    3e-09  27%  2dh9A  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN M
    3e-09  23%  2dnkA  [x.x.x] BRUNO-LIKE 4, RNA BINDING PROTEIN
    3e-09  21%  2dhsA  [x.x.x] CUG TRIPLET REPEAT RNA-BINDING PROTEIN 1
    4e-09  24%  2dnqA  [x.x.x] RNA-BINDING PROTEIN 4B
    5e-09  19%  2do4A  [x.x.x] SQUAMOUS CELL CARCINOMA ANTIGEN RECOGNIZED BY T-
    5e-09  37%  2dhgA  [x.x.x] TRNA SELENOCYSTEINE ASSOCIATED PROTEIN (SECP43)
    5e-09  20%  2dnpA  [x.x.x] RNA-BINDING PROTEIN 14
    6e-09  27%  2dnmA  [x.x.x] SRP46 SPLICING FACTOR
    7e-09  23%  2cqgA  [x.x.x] TAR DNA-BINDING PROTEIN-43
    7e-09  19%  2ek1B  [x.x.x] RNA-BINDING PROTEIN 12
    7e-09  22%  2e5jA  [x.x.x] METHENYLTETRAHYDROFOLATE SYNTHETASE DOMAIN
    8e-09  36%  1cvjH  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    8e-09  14%  2cpiA  [x.x.x] CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 4
    9e-09  12%  2e44A  [x.x.x] INSULIN-LIKE GROWTH FACTOR 2 MRNA BINDING
    1e-08  17%  2disA  [x.x.x] UNNAMED PROTEIN PRODUCT
    1e-08  10%  3dxbA  [x.x.x] THIOREDOXIN N-TERMINALLY FUSED TO PUF60(UHM)
    1e-08  17%  2dhaA  [x.x.x] FLJ20171 PROTEIN
    1e-08  23%  2dngA  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 4H
    1e-08  24%  2cq4A  [x.x.x] RNA BINDING MOTIF PROTEIN 23
    1e-08  13%  2diuA  [x.x.x] KIAA0430 PROTEIN
    2e-08  20%  2divA  [x.x.x] TRNA SELENOCYSTEINE ASSOCIATED PROTEIN
    2e-08  27%  2cqiA  [x.x.x] NUCLEOLYSIN TIAR
    2e-08  14%  2dnnA  [x.x.x] RNA-BINDING PROTEIN 12
    2e-08  24%  2ek1G  [x.x.x] RNA-BINDING PROTEIN 12
    2e-08  32%  2d9pA  [x.x.x] POLYADENYLATE-BINDING PROTEIN 3
    3e-08  15%  2cpyA  [x.x.x] RNA-BINDING PROTEIN 12
    3e-08  14%  2dnlA  [x.x.x] CYTOPLASMIC POLYADENYLATION ELEMENT BINDING
    3e-08  17%  2cphA  [x.x.x] RNA BINDING MOTIF PROTEIN 19
    4e-08  16%  2e5iA  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN L-LIKE
    5e-08  22%  2dgtA  [x.x.x] RNA-BINDING PROTEIN 30
    6e-08  23%  2dnhA  [x.x.x] BRUNO-LIKE 5, RNA BINDING PROTEIN
    8e-08  21%  2aymA  [x.x.x] U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
    1e-07  22%  2dnoA  [x.x.x] TRINUCLEOTIDE REPEAT CONTAINING 4 VARIANT
    1e-07  10%  3dxbE  [x.x.x] THIOREDOXIN N-TERMINALLY FUSED TO PUF60(UHM)
    2e-07  24%  2cpeA  [x.x.x] RNA-BINDING PROTEIN EWS
    3e-07  27%  2cpjA  [x.x.x] NON-POU DOMAIN-CONTAINING OCTAMER-BINDING
    8e-07  14%  2ditA  [x.x.x] HIV TAT SPECIFIC FACTOR 1 VARIANT
    8e-07  23%  2cpdA  [x.x.x] APOBEC-1 STIMULATING PROTEIN
    1e-06  19%  2do0A  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN M
    2e-06  15%  2e5gA  [x.x.x] U6 SNRNA-SPECIFIC TERMINAL URIDYLYLTRANSFERASE 1
    2e-06  20%  2dgwA  [x.x.x] PROBABLE RNA-BINDING PROTEIN 19
    3e-06  20%  3d2wA  [x.x.x] TAR DNA-BINDING PROTEIN 43
    4e-06  32%  2dguA  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN Q
    4e-06  15%  2dnrA  [x.x.x] SYNAPTOJANIN-1
    9e-06   6%  2ad9A  [x.x.x] POLYPYRIMIDINE TRACT-BINDING PROTEIN 1
    9e-06  24%  2cqhA  [x.x.x] IGF-II MRNA-BINDING PROTEIN 2 ISOFORM A
    1e-05  12%  2cq1A  [x.x.x] PTB-LIKE PROTEIN L
    2e-05  26%  2cq2A  [x.x.x] HYPOTHETICAL PROTEIN LOC91801
    3e-04  22%  2d9oA  [x.x.x] DNAJ (HSP40) HOMOLOG, SUBFAMILY C, MEMBER 17
:252

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1cvjF           ----------------------------------------------------------------------
1cvjD           ----------------------------------------------------------------------
1cvjC           ----------------------------------------------------------------------
1cvjA           ----------------------------------------------------------------------
2dhxA           ----------------------------------------------------------------------
2adcA           ----------------------------------------------------------------------
3bs9A           ----------------------------------------------------------------------
1cvjG           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------
1b7fA           ----------------------------------------------------------------------
2dgqA           ----------------------------------------------------------------------
3dedA           ----------------------------------------------------------------------
2dgoA           ----------------------------------------------------------------------
1drzA           ----------------------------------------------------------------------
1cx0A           ----------------------------------------------------------------------
2ek6A           ----------------------------------------------------------------------
2dgpA           ----------------------------------------------------------------------
2cqbA           ----------------------------------------------------------------------
2dgxA           ----------------------------------------------------------------------
3culA           ----------------------------------------------------------------------
3cunA           ----------------------------------------------------------------------
1cvjB           ----------------------------------------------------------------------
1d8zA           ----------------------------------------------------------------------
2dh7A           ----------------------------------------------------------------------
1a9nD           ----------------------------------------------------------------------
2e5hA           ----------------------------------------------------------------------
1audA           ----------------------------------------------------------------------
3d45A           ----------------------------------------------------------------------
2cpzA           ----------------------------------------------------------------------
2cqcA           ----------------------------------------------------------------------
1d9aA           ----------------------------------------------------------------------
3b4dA           ----------------------------------------------------------------------
3begB           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
2dnyA           ----------------------------------------------------------------------
2ek1A           ----------------------------------------------------------------------
2dh8A           ----------------------------------------------------------------------
2dk2A           ----------------------------------------------------------------------
2db1A           ----------------------------------------------------------------------
2cq0A           ----------------------------------------------------------------------
3ctrA           ----------------------------------------------------------------------
2a3jA           ----------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
2cpfA           ----------------------------------------------------------------------
3egnA           ----------------------------------------------------------------------
2cjkA           ----------------------------------------------------------------------
2adbA           ----------------------------------------------------------------------
2cqpA           ----------------------------------------------------------------------
2dnzA           ----------------------------------------------------------------------
2dgsA           ----------------------------------------------------------------------
1a9nB           ----------------------------------------------------------------------
3dedC           ----------------------------------------------------------------------
2cqdA           ----------------------------------------------------------------------
2ek1D           ----------------------------------------------------------------------
2bz2A           ----------------------------------------------------------------------
2dgvA           ----------------------------------------------------------------------
2cpxA           ----------------------------------------------------------------------
2cq3A           ----------------------------------------------------------------------
2dh9A           ----------------------------------------------------------------------
2dnkA           ----------------------------------------------------------------------
2dhsA           ----------------------------------------------------------------------
2dnqA           ----------------------------------------------------------------------
2do4A           ----------------------------------------------------------------------
2dhgA           ----------------------------------------------------------------------
2dnpA           ----------------------------------------------------------------------
2dnmA           ----------------------------------------------------------------------
2cqgA           ----------------------------------------------------------------------
2ek1B           ----------------------------------------------------------------------
2e5jA           ----------------------------------------------------------------------
1cvjH           ----------------------------------------------------------------------
2cpiA           ----------------------------------------------------------------------
2e44A           ----------------------------------------------------------------------
2disA           ----------------------------------------------------------------------
3dxbA           ----------------------------------------------------------------------
2dhaA           ----------------------------------------------------------------------
2dngA           ----------------------------------------------------------------------
2cq4A           ----------------------------------------------------------------------
2diuA           ----------------------------------------------------------------------
2divA           ----------------------------------------------------------------------
2cqiA           ----------------------------------------------------------------------
2dnnA           ----------------------------------------------------------------------
2ek1G           ----------------------------------------------------------------------
2d9pA           ----------------------------------------------------------------------
2cpyA           ----------------------------------------------------------------------
2dnlA           ----------------------------------------------------------------------
2cphA           ----------------------------------------------------------------------
2e5iA           ----------------------------------------------------------------------
2dgtA           ----------------------------------------------------------------------
2dnhA           ----------------------------------------------------------------------
2aymA           ----------------------------------------------------------------------
2dnoA           ----------------------------------------------------------------------
3dxbE           ----------------------------------------------------------------------
2cpeA           ----------------------------------------------------------------------
2cpjA           ----------------------------------------------------------------------
2ditA           ----------------------------------------------------------------------
2cpdA           ----------------------------------------------------------------------
2do0A           ----------------------------------------------------------------------
2e5gA           ----------------------------------------------------------------------
2dgwA           ----------------------------------------------------------------------
3d2wA           ----------------------------------------------------------------------
2dguA           ----------------------------------------------------------------------
2dnrA           ----------------------------------------------------------------------
2ad9A           ----------------------------------------------------------------------
2cqhA           ----------------------------------------------------------------------
2cq1A           ----------------------------------------------------------------------
2cq2A           ----------------------------------------------------------------------
2d9oA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QTTSTTPIPGQPNAPNQSGPGKTVMRSGGGQTWTDSTLLEWDPAHFRLFCGNLAGEVTDDSLLKAFSKYP
1cvjF           ----------------------------------------------SLYVGDLHPDVTEAMLYEKFSPAG
1cvjD           ----------------------------------------------SLYVGDLHPDVTEAMLYEKFSPAG
1cvjC           ----------------------------------------------SLYVGDLHPDVTEAMLYEKFSPAG
1cvjA           ----------------------------------------------SLYVGDLHPDVTEAMLYEKFSPAG
2dhxA           ----------------------------------------------AVEVRGLPPAVPDELLTLYFENRR
2adcA           -----------------------------------------GAGNSVLLVSNLNPEVTPQSLFILFGVYG
3bs9A           --------------------------------------------HFHVFVGDLSPEITTAAIAAAFAPFG
1cvjG           ----------------------------------------------SLYVGDLHPDVTEAMLYEKFSPAG
3d45B           -----------------------------------------QPKRDHVLHVTFPKEWKTSDLYQLFSAFG
1b7fA           ----------------------------------------------NLIVNYLPQDMTDRELYALFRAIG
2dgqA           -----------------------------------------DHDAIKLFVGQIPRGLDEQDLKPLFEEFG
3dedA           ----------------------------------GSWLVDGVSLDRFREFFELEAPLPGEAGGNIHTLAV
2dgoA           -----------------------------------------TSNHFHVFVGDLSPEITTEDIKAAFAPFG
1drzA           -----------------------------------------TRPNHTIYINNLNEKIKKDELKKSLHAIF
1cx0A           -----------------------------------------TRPNHTIYINNLNEKIKKDELKKSLHAIF
2ek6A           ---------------------------------------------TVIKVQNMPFTVSIDEILDFFYGYQ
2dgpA           -----------------------------------------DHDAIKLFIGQIPRNLDEKDLKPLFEEFG
2cqbA           -----------------------------------------ATTKRVLYVGGLAEEVDDKVLHAAFIPFG
2dgxA           -----------------------------------------SGNGADVQVSNIDYRLSRKELQQLLQEAF
3culA           ----------------------------------------------TIYINNLNEKIKKDELKKSLHAIF
3cunA           ----------------------------------------------TIYINNLNEKIKKDELKKSLHAIF
1cvjB           ----------------------------------------------SLYVGDLHPDVTEAMLYEKFSPAG
1d8zA           ----------------------------------------------NLIVNYLPQNMTQDEFKSLFGSIG
2dh7A           -----------------------------------------TSNHFHVFVGDLSPEITTEDIKSAFAPFG
1a9nD           ----------------------------------------------TIYINNMNDKIKKEELKRSLYALF
2e5hA           ------------------------------------------PSKSTVYVSNLPFSLTNNDLYRIFSKYG
1audA           -----------------------------------------TRPNHTIYINNLNEKIKKDELKKSLHAIF
3d45A           ISMANYLGSSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFG
2cpzA           -----------------------------------------GPEGANLFIYHLPQEFGDQDLLQMFMPFG
2cqcA           -----------------------------------------PDPNCCLGVFGLSLYTTERDLREVFSKYG
1d9aA           ----------------------------------------------NLYVSGLPKTMSQKEMEQLFSQYG
3b4dA           --------------------------------------------ARSIYVGNVDYGATAEELEAHFHGCG
3begB           ----------------------------------------------RVVVSGLPPSGSWQDLKDHMREA-
3efxJ           -------------------------------------------------------QNITELCSEYHNTQI
2dnyA           ----------------------------------------------NMVDPKDIDDDLEGEVTEECGKFG
2ek1A           ---------------------------------------------TVIKVQNPF-TVSIDEILDFFYGYQ
2dh8A           ----------------------------------------------KLFVGGLDWSTTQETLRSYFSQYG
2dk2A           ----------------------------------SSGDPEVMAKVKVLFVRNLATTVTEEILEKSFSEFG
2db1A           ---------------------------------------------YVVKLRGLPWSCSIEDVQNFLSDCT
2cq0A           -----------------------------------------ADDNATIRVTNLSEDTRETDLQELFRPFG
3ctrA           ----------------------------------------------HVLHVTFPKEWKTSDLYQLFSAFG
2a3jA           -----------------------------------------TEPSQVVLITNINPEVPKEKLQALLYALA
3b4mD           --------------------------------------------ARSIYVGNVDYGATAEELEAHFHGCG
2cpfA           -----------------------------------------SSGSSGLFIKNLNFSTTEETLKGVFSKVG
3egnA           -----------------------------------------GEPNCRIYVKNLAKHVQEKDLKYIFGRYV
2cjkA           ----------------------------------------------KMFIGGLNWDTTEDNLREYFGKYG
2adbA           ---------------------------------------AGQSPVLRIIVENLFYPVTLDVLHQIFSKF-
2cqpA           ----------------------------------------------IIKVQNMPFTVSIDEILDFFYGYQ
2dnzA           -----------------------------------------------LYVGSLHFNITEDMLRGIFEPFG
2dgsA           ----------------------------------------------KIFVGGIPHNCGETELREYFKKFG
1a9nB           ----------------------------------------------TIYINNMNDKIKKEELKRSLYALS
3dedC           ---------------------------------------DGVSLDRFREFFELEAPLPGEAGGNIHTLAG
2cqdA           -----------------------------------------DTTFTKIFVGGLPYHTTDASLRKYFEGFG
2ek1D           ---------------------------------------------TVIKVQNPF-TVSIDEILDFFYGYQ
2bz2A           -----------------------------------------PRKGNTLYVYGE--DMTPTLLRGAFSPFG
2dgvA           -----------------------------------------SSGACQIFVRNLPFDFTWKMLKDKFNECG
2cpxA           -----------------------------------------GEPNKVLYLKNLSPRVTERDLVSLFARFQ
2cq3A           ----------------------------------------------RLHVSNIPFRFRDPDLRQMFGQF-
2dh9A           -----------------------------------------SSGSSGIFVRNLPFDFTWKMLKDKFNECG
2dnkA           ---------------------------------------RQPPSHRKLFVGMLNKQQSEDDVRRLFEAFG
2dhsA           ----------------------------------------NAVEDRKLFIGMISKKCTENDIRVMFSSF-
2dnqA           ---------------------------------------SGSSGMVKLFIGNLPREATEQEIRSLFEQYG
2do4A           -----------------------------------------SLEKHKLFISGLPFSCTKEELEEICKAHG
2dhgA           -----------------------------------------SGPEYSLFVGDLTPDVDDGMLYEFFVKVY
2dnpA           ---------------------------------------GSSGNTWKIFVGNVSAACTSQELRSLFERRG
2dnmA           -----------------------------------------VDGMITLKVDNLTYRTSPDSLRRVFEKYG
2cqgA           -----------------------------------------VQKTSDLIVLGLPWKTTEQDLKEYFSTFG
2ek1B           ---------------------------------------------TVIKVQNPF-TVSIDEILDFFYGYQ
2e5jA           ---------------------------------------EGAPLAADVYVGNLPRDARVSDLKRALRELG
1cvjH           -----------------------------------------------LYVGDLHPDVTEAMLYEKFSPAG
2cpiA           -----------------------------------------VVQKNLVFVVGLSQRLADPEVLKRPEYFG
2e44A           -----------------------------------------RQRIRKLQIRNIPPHLQWEVLDSLLVQY-
2disA           -----------------------------------------SSGNCRLFIGGIPKMKKREEILEEIAKVT
3dxbA           ------------------------------------------NMVDPKDIDDDLEGEVTEECGKFGAVNR
2dhaA           --------------------------SSGGGTSNEVAQFLSKENQVIVRMRGLPFTATAEEVVAFFGQHC
2dngA           -----------------------------------------TEPPYTAYVGNLPFNTVQGDIDAIFKDLS
2cq4A           -----------------------------------------ERDARTVFCMQLAARIRPRDLEDFFSAVG
2diuA           -----------------------------------------SGCHTLLYVYNLPANKDGKSVSNRLRRLS
2divA           ----------------------------------------------SLWMGDLEPYMDENFISRAFATMG
2cqiA           -----------------------------------SGMMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIG
2dnnA           -----------------------------GSSGSSGKPLPINPDDLYVSVHGMPFSAMENDVRDFFHGL-
2ek1G           ----------------------------------------------VIKVQNPF-TVSIDEILDFFYGYQ
2d9pA           -----------------------------------------RYQVVNLYVKNLDDGIDDERLRKAFSPFG
2cpyA           -----------------------------------------NSAKVCAHITNIPFSITKMDVLQFLEGIP
2dnlA           -----------------------------------------SSGSRKVFVGGLPPDIDEDEITASFRRFG
2cphA           -----------------------------------------KQTTSKILVRNIPFQANQREIRELFSTFG
2e5iA           -----------------------------------------GNKVLLLSIQNPLYPITVDVLYTVCNPVG
2dgtA           ----------------------------------------------KLHVGNISPTCTNQELRAKFEEYG
2dnhA           ----------------------------------------------KLFVGMLNKQQSEEDVLRLFQPFG
2aymA           -----------------------------------------QPPNQILFLTNLPEETNEMMLSMLFNQFP
2dnoA           ------------------------------------------GEDRKLFVGMLGKQQTDEDVRKMFEPFG
3dxbE           ----------------------------------------LRNMVDPKDIDDDLEGEVTEECGKFGAVNR
2cpeA           -----------------------------------------------IYVQGLNDSVTLDDLADFFKQCG
2cpjA           -----------------------------------------FTQRSRLFVGNLPPDITEEEMRKLFEKY-
2ditA           --------------------------------HERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFG
2cpdA           ---------------------------------------DTMSSVKILYVRNLMLSTSEEMIEKEFNNIK
2do0A           -----------------------------------------------VFVANLDYKVGWKKLKEVFSMAG
2e5gA           -----------------------------------------SSGLRSVFVSGFPRGVDSAQLSEYFLAFG
2dgwA           --------------------------------------------CHTVKLRGAPFNVTEKNVMEFLAPLK
3d2wA           ----------------------------------------------KVFVGRCTEDMTAEELQQFFCQYG
2dguA           ---------------------------------------SGMAKVKVLFVRNLANTVTEEILEKAFSQF-
2dnrA           -----------------------------------------VSIKSSLPENNFFDDALIDELLQQFASF-
2ad9A           -----------------------------------------GVPSRVIHIRKLPIDVTEGEVISLGLPF-
2cqhA           -----------------------------------------SSGMNKLYIGNLSPAVTADDLRQLFGDRK
2cq1A           -----------------------------------------GAPSRVLHIRKLPGEVTETEVIALGLPFG
2cq2A           --------------------------------------------------GGLGNGVSRNQLLPVLEKCG
2d9oA           --------------------------------------------------DESKGGYSKDVLLRLLQKYG


                         +         .         .         .         .         *         .:210
query           SVQKARVIRDKRTEKSKGYGFVSFSDGEDYFRAAREMQGKYIGSHPVLLRRAMTEIRPxxxxxxxxxxxx
1cvjF           PILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQ-----------------
1cvjD           PILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWS------------------
1cvjC           PILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQ-----------------
1cvjA           PILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWS------------------
2dhxA           RSGGGPVLSWQRL---GCGGVLTFREPADAERVLAQADHELHGA--------------------------
2adcA           -----DVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQ---------------
3bs9A           RISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWA------------------
1cvjG           PILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWS------------------
3d45B           NIQISW--------IDDTSAFVSLSQPEQVQIAVNTSKY-----AESYRIQTYAE---------------
1b7fA           PINTCRIMRDYKTGYSYGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYAR-----------------
2dgqA           RIYELTVLKDRLTGLHKGCAFLTYCARDSALKAQSALHEQKGMNRPIQVKPAASEGR-------------
3dedA           LYQLGRVPSVTDRFEWNGFSFEVVDDRTRVDKILVQRH--------------------------------
2dgoA           RISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWA------------------
1drzA           SRFGQILDILVSRSLKRGQAFVIFKEVSSATNALRSQGFPFYDKPRIQYAKTDSDIIA------------
1cx0A           SRFGQILDILVSRSLKRGQAFVIFKEVSSATNALRSQGFPFYDKPRIQYAKTDSDIIA------------
2ek6A           VIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKV-----------------------
2dgpA           KIYELTVLKDRFTGMHKGCAFLTYCERESALKAQSALHEQPGMNRPIQVKPADSESR-------------
2cqbA           DITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLA------------------
2dgxA           ARHGKVKSELSPHTDYQLKAVVQMENLQDAIGAVNSLHRYKIGSKKILVSLA------------------
3culA           SRFGQILDILVSRSLKRGQAFVIFKEVSSATNALRSQGFPFYDKPRIQYAKTDSDIIA------------
3cunA           SRFGQILDILVSRSLKRGQAFVIFKEVSSATNALRSQGFPFYDKPRIQYAKTDSDIIA------------
1cvjB           PILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV-----------------------
1d8zA           DIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYA------------------
2dh7A           KISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWA------------------
1a9nD           SQFGHVVDIALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYA------------------
2e5hA           KVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAINNKQLFGRVIKASIAI-----------------
1audA           SRFGQILDIVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYA------------------
3d45A           NI--------QISWIDDTSAFVSLSQPEQVQIAVNTSKYA------------------------------
2cpzA           NVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLK------------------
2cqcA           PIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVSGP------------------
1d9aA           RIITSRILLDQATGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVK------------------
3b4dA           SVNRVTILCDKFSGHPKGFAYIEFSDKES-VRTSLALDESLFRGRQIKVIPK------------------
3begB           ------GDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYI------------------
3efxJ           YTINDKILSYTESLAGREMAIITFKNGATFQVEVQKKA---IERMKDTLRIA------------------
2dnyA           AVNRVIIYQEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVY------------------
2ek1A           VIPG--SVCLKYNEKGPTGEAVAFESRDEATAAVIDLNDRPIGSRKVKLSGP------------------
2dh8A           EVVDCVIMKDKTTNQSRGFGFVKFKD-PNCVGTVLASRPHTLDGRNIDPKPC------------------
2dk2A           --------KLERVKKLKDYAFVHFEDRGAAVKAMDEMNGKEIEGEEIEIVLA------------------
2db1A           IHDGVAGFIYTREGRQSGEAFVELESEDD-VKLALKKDRESMGHRYIEVFKS------------------
2cq0A           SISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWA------------------
3ctrA           NIQISWIDDT-----SAFVSLSQPEQVKIAVNTSKYAESYRIQTYAE-----------------------
2a3jA           SSQGDILIVVDLSDDNSGKAYIVFATQESAQAFVEAFQGYPFQGNPLVITFS------------------
3b4mD           SVNRVTILCDKFSGHPKGFAYIEFSDKES-VRTSLALDESLFRGRQI-----------------------
2cpfA           AIKSCTISKKKNVLLSMGFGFVEYKKPEQAQKALKQLQGHTVDGHKLEVRIS------------------
3egnA           DFSSETQRIMFKEGRMKGQAFIGLPNEKAAAKALKEANGYVLFGKPMVVQFA------------------
2cjkA           TVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQHILDGKVID------------------------
2adbA           ---GTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDF-----------------
2cqpA           VIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLG------------------
2dnzA           KIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHV------------------
2dgsA           VVTEVVMIYDAEKQRPRGFGFITFEDEQS-VDQAVNMHFHDIMGKKVEVKRA------------------
1a9nB           QFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYA------------------
3dedC           VLYQLGRVPVTDRFEWNGFSFEVVDDRTRVDKILVQRH--------------------------------
2cqdA           DIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNP-IIDGRKANVNLAYLGAKP------------
2ek1D           VIPG--SVCLKYNEKGPTGEAVAFESRDEATAAVIDLNDRPIGSRKVKLS--------------------
2bz2A           ------NIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIA------------------
2dgvA           HVLY--ADIKMENGKSKGCGVVKFESPEVAERACRMMNGMKLSGREIDVRID------------------
2cpxA           EKKGPPIQFRMMTGRMRGQAFITFPNKEIAWQALHLVNGYKLYGKILVIEFG------------------
2cq3A           -GKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNA------------------
2dh9A           HVL--YADIKMENGKSKGCGVVKFESPEVAERACRMMNGMKLSGREIDVRID------------------
2dnkA           NI-EECTILRGPDGNSKGCAFVKYSSHAEAQAAINALHGSPGASSSLVVKFA------------------
2dhsA           GQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQGCSSPMVVKFA------------------
2dnqA           KV--------LECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEAS------------------
2do4A           TVKDLRLVTNRAG-KPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAIS------------------
2dhgA           PSCRGGKVVLDQTGVSKGYGFVKFTDELEQKRALTECQGAVLGSKPVRLSVA------------------
2dnpA           --------RVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELS------------------
2dnmA           RVGDVYIPREPHTKAPRGFAFVRFHDRRDAQDAEAAMDGAELDGRELRVQVA------------------
2cqgA           EVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHM--IDGRWCDCKLPNSK---------------
2ek1B           VIPGSVCLKYNEKGPT--GEAVAFESRDEATAAVIDLNDRPIGSRKVKLS--------------------
2e5jA           SVPLRLTWQGPRR-----RAFLHYPDSAAAQQAVSCLQGLRLGTDTLRVALA------------------
1cvjH           PILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV-----------------------
2cpiA           KFGKIHKVSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLG------------------
2e44A           --GVVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYI------------------
2disA           EGVLDVIVSAADKMKNRGFAFVEYESHRAAAMARRKLMPGRLWGHQIAVDWA------------------
3dxbA           VIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVY------------------
2dhaA           PITGGKEGITYPDGRPTGDAFVLFACEEYA-QNALRKHKDLLGKRYIELFRS------------------
2dngA           IR-SVRLVRDKDTDKFKGFCYVEFDEVDS-LKEALTYDGALLGDRSLRVDIA------------------
2cq4A           KVRDVRIISDRNSRRSKGIAYVEFCEIQS-VPLAIGLTGQRLLGVPIIVQAS------------------
2diuA           DNCGGKVLSITGC-----SAILRFINQDSAERAQKRMENEDVFGNRIIVSFT------------------
2divA           ETVMSVKIIRNRLGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATY------------
2cqiA           PCK--SCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWA------------------
2dnnA           -RVDAVHLLKDHVGRNNGNGLVKFLSPQD-TFEALKRNRMLMIQRYVEVSPA------------------
2ek1G           --VIPGSVCLKYNEKGPTGEAVAFESRDEATAAVIDLNDRPIGSRKVKLS--------------------
2d9pA           TITSAKVMMEGGRS--KGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALA------------------
2cpyA           VDENAVHVLVDNNGQGLGQALVQFKNEDD-ARKSERLHRKKLNGREAFVHVV------------------
2dnlA           PLVVDHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGK-LYLCVSSPTIKDKP------------
2cphA           ELKTVRLKKMTGTGAHRGFGFVDFITKQDAKKAFNALCSTHLYGRRLVLEWA------------------
2e5iA           KV-----QRIVIFKRNGIQAMVEFESVLCAQKAKAALNGADIYAGCCTLKIEYARPTR------------
2dgtA           --------PVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLS------------------
2dnhA           VIDE-CTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQGASSSLVVKFA------------------
2aymA           GFKEVRLVPNRHDIAFVEFTTE-----LQSNAAKEALQGFKIPTHAMKITFA------------------
2dnoA           TI-DECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSPGASSSLVVKFA------------------
3dxbE           VIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVY------------------
2cpeA           VVKMNKRTGQPETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLA------------------
2cpjA           -----GKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFA------------------
2ditA           QIR----KLLLFDRHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAW------------------
2cpdA           PGAVERVKKIRDYA------FVHFSNREDAVEAMKALNGKVLDGSPIEVTLA------------------
2do0A           VVVRADILEDKDGKSRGIGTVTFEQS-IEAVQAISMFNGQLLFDRPMHVKMD------------------
2e5gA           -----PVASVVMDKDKGVFAIVEMGDVGA-REAVLSQSQHSLGGHRLRVRPR------------------
2dgwA           --PVAIRIVRNAHGNKTGYIFVDFSNEEEV-KQALKCNREYMGGRYIEVFRE------------------
3d2wA           EVVDVFIPKPF-----RAFAFVTFADDKVAQSLC--GEDLIIKGISVHISNA------------------
2dguA           -------GKLERVKKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFA------------------
2dnrA           -------GEVILIRFVEDKMWVTFLEGSS-ALNVLSLNGKELLNRTITIALK------------------
2ad9A           --GKVTNLLMLKGKNQAFIEMNTEEAANT-MVNYYTSVTPVLRGQPIYIQFS------------------
2cqhA           LPLAGQVLLKSG------YAFVDYPDQNWAIRAIETLSGKVLHGKIMEVDYS------------------
2cq1A           KVTNILMLKGKNQ---AFLELATEEAAITMVNYY-SAVTPHLRNQPIYIQYS------------------
2cq2A           LVDALLMPPN------KPYSFARYRTTEESKRAYVTLNGKEVV---------------------------
2d9oA           -----EVLNLVLSSKKPGTAVVEFATVKAAELAVQNEVG--LVDNPLKISWL------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1cvjF           ------------------------------------------
1cvjD           ------------------------------------------
1cvjC           ------------------------------------------
1cvjA           ------------------------------------------
2dhxA           ------------------------------------------
2adcA           ------------------------------------------
3bs9A           ------------------------------------------
1cvjG           ------------------------------------------
3d45B           ------------------------------------------
1b7fA           ------------------------------------------
2dgqA           ------------------------------------------
3dedA           ------------------------------------------
2dgoA           ------------------------------------------
1drzA           ------------------------------------------
1cx0A           ------------------------------------------
2ek6A           ------------------------------------------
2dgpA           ------------------------------------------
2cqbA           ------------------------------------------
2dgxA           ------------------------------------------
3culA           ------------------------------------------
3cunA           ------------------------------------------
1cvjB           ------------------------------------------
1d8zA           ------------------------------------------
2dh7A           ------------------------------------------
1a9nD           ------------------------------------------
2e5hA           ------------------------------------------
1audA           ------------------------------------------
3d45A           ------------------------------------------
2cpzA           ------------------------------------------
2cqcA           ------------------------------------------
1d9aA           ------------------------------------------
3b4dA           ------------------------------------------
3begB           ------------------------------------------
3efxJ           ------------------------------------------
2dnyA           ------------------------------------------
2ek1A           ------------------------------------------
2dh8A           ------------------------------------------
2dk2A           ------------------------------------------
2db1A           ------------------------------------------
2cq0A           ------------------------------------------
3ctrA           ------------------------------------------
2a3jA           ------------------------------------------
3b4mD           ------------------------------------------
2cpfA           ------------------------------------------
3egnA           ------------------------------------------
2cjkA           ------------------------------------------
2adbA           ------------------------------------------
2cqpA           ------------------------------------------
2dnzA           ------------------------------------------
2dgsA           ------------------------------------------
1a9nB           ------------------------------------------
3dedC           ------------------------------------------
2cqdA           ------------------------------------------
2ek1D           ------------------------------------------
2bz2A           ------------------------------------------
2dgvA           ------------------------------------------
2cpxA           ------------------------------------------
2cq3A           ------------------------------------------
2dh9A           ------------------------------------------
2dnkA           ------------------------------------------
2dhsA           ------------------------------------------
2dnqA           ------------------------------------------
2do4A           ------------------------------------------
2dhgA           ------------------------------------------
2dnpA           ------------------------------------------
2dnmA           ------------------------------------------
2cqgA           ------------------------------------------
2ek1B           ------------------------------------------
2e5jA           ------------------------------------------
1cvjH           ------------------------------------------
2cpiA           ------------------------------------------
2e44A           ------------------------------------------
2disA           ------------------------------------------
3dxbA           ------------------------------------------
2dhaA           ------------------------------------------
2dngA           ------------------------------------------
2cq4A           ------------------------------------------
2diuA           ------------------------------------------
2divA           ------------------------------------------
2cqiA           ------------------------------------------
2dnnA           ------------------------------------------
2ek1G           ------------------------------------------
2d9pA           ------------------------------------------
2cpyA           ------------------------------------------
2dnlA           ------------------------------------------
2cphA           ------------------------------------------
2e5iA           ------------------------------------------
2dgtA           ------------------------------------------
2dnhA           ------------------------------------------
2aymA           ------------------------------------------
2dnoA           ------------------------------------------
3dxbE           ------------------------------------------
2cpeA           ------------------------------------------
2cpjA           ------------------------------------------
2ditA           ------------------------------------------
2cpdA           ------------------------------------------
2do0A           ------------------------------------------
2e5gA           ------------------------------------------
2dgwA           ------------------------------------------
3d2wA           ------------------------------------------
2dguA           ------------------------------------------
2dnrA           ------------------------------------------
2ad9A           ------------------------------------------
2cqhA           ------------------------------------------
2cq1A           ------------------------------------------
2cq2A           ------------------------------------------
2d9oA           ------------------------------------------