[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_01277

[Show Plain Result]

#ERROR : Can't open dsspfile "2asfA.bssp"
#ERROR : Can't open dsspfile "3db0A.bssp"
#ERROR : Can't open dsspfile "3ba3A.bssp"

## Summary of PDB Search
:266
    2e-06  10%  2asfA  [x.x.x] HYPOTHETICAL PROTEIN RV2074
    6e-05  18%  3db0A  [x.x.x] LIN2891 PROTEIN
    3e-04  12%  3ba3A  [x.x.x] PYRIDOXAMINE 5'-PHOSPHATE OXIDASE-LIKE PROTEIN
:266

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2asfA           ----------------------------------------------------------------------
3db0A           ----------------------------------------------------------------------
3ba3A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxGYVSSRIMNLARATDGKGLPICIAATHVDGLILTLTPNSHSYNYRSAVLHGYATLVTDVE
2asfA           ----------NSPHVVAVGFTFDPKTHIARVITTGGSQKAVNADRSGLSQVDGARWLSLEGRAAVNSDID
3db0A           -------------QHQVGVLT--SVQGDFPHARYTFLHDGLTLYVLIGYDSPGSAFLEINGLASLEEDES
3ba3A           ----------NEADVKIVNFVWYEAQPDTDIAFITIPNDGTAGN--PYLRAQHVKLQRSTKTTDLLPQYL


                         +         .         .         .         .         *         .:210
query           EKLWAMKLITNSVVPQRWENTRIPPDGAEMQSTTILKVKIVDGSGKIRDGGVSDExxxxxxxxxxxxxxx
2asfA           AVRDAELRYA------------------------------------------------------------
3db0A           IKERIWENISKDWFQFVVI--KIVPEQIRI----------------------------------------
3ba3A           ETVPNYQQVWDAIGSTL----------------VVFELKLTDLFVDAGVGGEKQT---------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2asfA           --------------------------------------------------------
3db0A           --------------------------------------------------------
3ba3A           --------------------------------------------------------