[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_01629

[Show Plain Result]

#ERROR : Can't open dsspfile "2bnxB.bssp"
#ERROR : Can't open dsspfile "2bapB.bssp"
#ERROR : Can't open dsspfile "3eg5B.bssp"
#ERROR : Can't open dsspfile "2bapB.bssp"

## Summary of PDB Search
:694
    8e-12  21%  2bnxB  [x.x.x] DIAPHANOUS PROTEIN HOMOLOG 1
    1e-09  16%  2bapB  [x.x.x] DIAPHANOUS PROTEIN HOMOLOG 1
    7e-04  29%  3eg5B  [x.x.x] PROTEIN DIAPHANOUS HOMOLOG 1
    5e-04  24%  2bapB  [x.x.x] DIAPHANOUS PROTEIN HOMOLOG 1(query 553->624)
:694

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bnxB           ----------------------------------------------------------------------
2bapB           ----------------------------------------------------------------------
3eg5B           ----------------------------------------------------------------------
2bapB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bnxB           ----------------------------------------------------------------------
2bapB           ----------------------------------------------------------------------
3eg5B           ----------------------------------------------------------------------
2bapB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bnxB           ----------------------------------------------------------------------
2bapB           ----------------------------------------------------------------------
3eg5B           ----------------------------------------------------------------------
2bapB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bnxB           ----------------------------------------------------------------------
2bapB           ----------------------------------------------------------------------
3eg5B           ----------------------------------------------------------------------
2bapB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPTDFVHYLKEVQKPEIVEVSKLHKLRILLRN
2bnxB           ---------------------------------------AMMYIQELRSGLRDMHL-LSCLESLRVSLNN
2bapB           ---------------------------------------AMMYIQELRSGLRDMHL-LSCLESLRVSLNN
3eg5B           ------------------------------------------YIQELRSGLRDMHL-LSCLESLRVSLTS
2bapB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ETISWVESFISHGGMEQLVDLLYRILKVEWRXXXXXXXXXXXXXCIKALCTTSPALHQLCKIGDDLFPTL
2bnxB           NPVSWVQTFG-AEGLASLLDILKRLEKEETSGNYDSRNQHEIIRCLKAFMNNKFGIKTMLE--TEEGILL
2bapB           NPVSWVQTFGAEG----LASLLDILKRLHDE--KDSRNQHEIIRCLKAFMNNKFGIKTMLETEEGIL--L
3eg5B           HPVSWVQTFG-AEGLASLLDILKRLH--------------------------------------------
2bapB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LRMLFGEEKKGPSEFATRNXXXXXXXXXXXXATFEEVATRARTILSYMHDPKPPKESAPLPFIAEMHQAR
2bnxB           LVRAMDPAVPNMMIDAA-----------------------------------------------------
2bapB           LVRAMDPAVPNMMIDAAK--------LLSALCILPQPEDMNERVLEAMAEMDEVERFQPLLDGLKSGTSI
3eg5B           ----------------------------------------------------------------------
2bapB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           PYQLWCKEMSNVTKEVFWIFLHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDATNYLAT
2bnxB           ----------------------------------------------------------------------
2bapB           ALKVGCLQLINALAEELDFRVH------------------------------------------------
3eg5B           ----------------------------------------------------------------------
2bapB           --------------------------------------------------------------TSIALKVG


                         .         .         .         *         .         .         .:630
query           HLDLINGLLASLPTIEERNELRTHLRASGLEKVMGRSLRTCKEKLYPAVHEALKVWVSAAADDExxxxxx
2bnxB           ----------------------------------------------------------------------
2bapB           ----------------------------------------------------------------------
3eg5B           ----------------------------------------------------------------------
2bapB           CLQLINALITPAEELDFRVHIRSELMRLGLHQV----LQELREIENEDMKVQLCVFDEQGDEDF------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bnxB           ----------------------------------------------------------------
2bapB           ----------------------------------------------------------------
3eg5B           ----------------------------------------------------------------
2bapB           ----------------------------------------------------------------