[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_01668

[Show Plain Result]

#ERROR : Can't open dsspfile "1agmA.bssp"
#ERROR : Can't open dsspfile "1ayxA.bssp"
#ERROR : Can't open dsspfile "3c67A.bssp"
#ERROR : Can't open dsspfile "1cqyA.bssp"
#ERROR : Can't open dsspfile "1ac0A.bssp"
#ERROR : Can't open dsspfile "3d3iA.bssp"
#ERROR : Can't open dsspfile "2c3vA.bssp"
#ERROR : Can't open dsspfile "2c3xB.bssp"

## Summary of PDB Search
:628
    5e-72  62%  1agmA  [x.x.x] GLUCOAMYLASE-471
    6e-50  33%  1ayxA  [x.x.x] GLUCOAMYLASE
    8e-24  12%  3c67A  [x.x.x] UNCHARACTERIZED PROTEIN YGJK
    3e-18  24%  1cqyA  [b.3.1] BETA-AMYLASE
    5e-17  54%  1ac0A  [x.x.x] GLUCOAMYLASE
    4e-13  13%  3d3iA  [x.x.x] UNCHARACTERIZED PROTEIN YGJK
    4e-08  14%  2c3vA  [x.x.x] ALPHA-AMYLASE G-6
    4e-04  12%  2c3xB  [x.x.x] ALPHA-AMYLASE G-6
:628

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxALQSILDNIGDDGAKVQGAHAGIVVA
1agmA           --------------------------------------------ARTAILNNIGADGAWVSGADSGIVVA
1ayxA           ---------------------------------------------LYYLLQNIAYPEGQFNNGVPGTVIA
3c67A           ----------------------------------------------------------------------
1cqyA           ----------------------------------------------------------------------
1ac0A           ----------------------------------------------------------------------
3d3iA           ----------------------------------------------------------------------
2c3vA           ----------------------------------------------------------------------
2c3xB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SPSRADPDYFYTWTRDAALVFKHLIDAFVAGNHDSQDRIHEYITAQSYLQTVSNPSGTLSTGGLGEPKFH
1agmA           SPSTDNPDYFYTWTRDSGLVIKTLVDLFRNGDTDLLSTIEHYISSQAIIQGVSNPSGDLSSGGLGEPKFN
1ayxA           SPSTSNPDYYYQWTRDSAITFLTVLSELEDNNTTLAKAVEYYINTSYNLQRTSNPSGSFDDEGLGEPKFN
3c67A           -AWSVMEVYNVTQDKTWVAEMYPKLVAY-----------HDWWLRNRDHNGNGVPEY--------GATRD
1cqyA           ----------------------------------------------------------------------
1ac0A           ----------------------------------------------------------------------
3d3iA           ----------------------------------------------------------------------
2c3vA           ----------------------------------------------------------------------
2c3xB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VDQSAFTGSWGRPQADGPALRATAMITYAKWLIANGHEDAAKSIVWPVVQNDLSYVGQFWNSTGFDLWEE
1agmA           VDETAYTGSWGRPQRDGPALRATAMIGFGQWLLDNGYTSAATEIVWPLVRNDLSYVAQYWNQTGYDLWEE
1ayxA           TDGSAYTGAWGRPQNDGPALRAYAISRYLNDVSGDINFSSTEDIYKNIIKPDLEYVIGYWDSTGFDLWEE
3c67A           KAHNTESGEMLFTVKKGDKEETQSGLNNYAR----VVEKGQYDSLEIPAQVAASWESGRDDAAVFGFIDK
1cqyA           ----------------------------------------------------------------------
1ac0A           ----------------------------------------------------------------------
3d3iA           LNNYARVVEKGQYDSLEIPAQVAAS-WESGRDDAAVFGFIDKEQLDKYVANKRSDWTVKFAENRSQDGTL
2c3vA           ----------------------------------------------------------------------
2c3xB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VQGSSFFTAIAQHRALAEGNNLARQLGTDCPHCESQAPQILCFLQSFWTGSNIIANFGGDRSGLDANSLL
1agmA           VNGSSFFTIAVQHRALVEGSAFATAVGSSCSWCDSQAPQILCYLQSFWTGSYILANFDSSRSGKDTNTLL
1ayxA           NQGRHFFTSLVQQKALAYAVDIAKSFDDGDFTLSSTASTLESYLSGSDGGHIVENPDLLQQNGLDSATYI
3c67A           EQLDKYVANGGKRSDWTVK--FAENRSQDGTLLGYSLLQESVDQASYYSDNHYLAEMATILGKPEADYIN
1cqyA           ----------------------------------------------------------------------
1ac0A           ----------------------------------------------------------------------
3d3iA           LGYSLLQESVDSYYSDNHYLAEATILGKPAKRYRQLAQQLADYINTCFD---------------------
2c3vA           ----------------------------------------------------------------------
2c3xB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GIIHNFDPEADCDDNTFQPCSSRALANHKKVTDSFREIYPINSGMEGDQAVAVGRYAEDVYYGGQPWYLA
1agmA           GSIHTFDPEAGCDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLSDSEAVAVGRYPEDSYYNGNPWFLC
1ayxA           GPLLTHDIGE-SSSTPFDVDNEYVLQSYYLLLEDNKDRYSVNSAY--SAGAAIGRYPEDGSSEGNPWFLA
3c67A           TCMFDPTTQFYYDVRIEDKPLANGCAGKPIVERGKEGWSPLFNGAATQNADAVVKVMLDPKEFNTFVPLG
1cqyA           ----------------------------------------------------------------------
1ac0A           ----------------------------------------------------------------------
3d3iA           ---PTTQFYYDVRIEDKPLANGCAGKPIVERGKGPEGWSPLFNGAATQNADAVVKVLDPKEFNT-FVPLG
2c3vA           ----------------------------------------------------------------------
2c3xB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           TFASAELLYDAIYQWNHTGKITITDVSLPFFQSIYKSAQVGTYSSSTNVFSEIIANVGSYADGYLNVARK
1agmA           TLAAAEQLYDALYQWDKQGSLEITDVSLDFFKALYSGAATGTYSSSSSTYSSIVSAVKTFADGFVSIVET
1ayxA           TAYAAQVPYKLAYDAKSSNDITINKINYDFFNKYIVSSDSVTIKSGSDEFNTVADNLVTFGDSFLQVILD
3c67A           TAALTNPAFGADIYWRGRVWVDQFWFGLKGM------ERYGYRDDALKLADTFFRHAKGLTA--------
1cqyA           ----------------------------------------------------------------------
1ac0A           ----------------------------------------------------------------------
3d3iA           TAALTNPAFGADIYWRGRVWVDQFWFGLKGERYGYRDD-------ALKLADTFFRHAKGLTA--------
2c3vA           ----------------------------------------------------------------------
2c3xB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           YTPCSGALAEQFSRNDGTPLSASDLTWSYAALLTAKERRESVVPGSWGQKSAHDVPPTCLATSAAGSYQT
1agmA           HAASNGSLSEQFDKSDGDELSARDLTWSYAALLTANNRRNSVVPPSWGETSASSVPGTCAATSASGTYSS
1ayxA           HINDDGSLNEQLNRYTGYSTGAYSLTWSSGALLEAIRLRNKVKALA------------------------
3c67A           ----DGPIQENYNPLTGAQQGAPNFSWSAAHLYMLYNDFF------------------------------
1cqyA           ----------------------------------------------------------------------
1ac0A           ----------------------------------------------------------------------
3d3iA           ----DGPIQENYNPLTGAQQGAPNFSWSAAHLYLYNDF--------------------------------
2c3vA           ----------------------------------------------------------------------
2c3xB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           ATxxxxxxxxxxxxxxxxxxxxxxxSSVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYE
1agmA           VT--------------------------------------------------------------------
1ayxA           ----------------------------------------------------------------------
3c67A           ----------------------------------------------------------------------
1cqyA           -------------------------TPVMQTIVKNVPTTIGDTVYITGNRAELGSWDTKQYPIQLYY--D
1ac0A           ---------------------------VAVTFDLTATTTYGENIYLVGSISQLGDWETSDGIALSADKYT
3d3iA           ----------------------------------------------------------------------
2c3vA           ---------------------------------TIYYKTGWTHPHIHY-SLNQGAWTTLPGVPL-----T
2c3xB           --------------------------------------------------------------------KS


                         .         .         .         *         .         .         .:630
query           ASCPLWSIQIDLAAGKKFDYRYIRKSDDGRVVWESDPNRSYTVPKNLEYQRRPSSSPAIQQRAKxxxx
1agmA           --------------------------------------------------------------------
1ayxA           --------------------------------------------------------------------
3c67A           --------------------------------------------------------------------
1cqyA           SHSNDWRGNVVLPAERNIEFKAFIKSKDGTVKWQTIQQSWNPVPLK----------------------
1ac0A           SSDPLWYVTVTLPAGESFEYKFIRIESDDSVEWESDPNREYTVP------------------------
3d3iA           --------------------------------------------------------------------
2c3vA           KSEEGVKVTIEAEEGSQLRAAFN----NGSGQWDNNQGRDYDFS------------------------
2c3xB           EYEGYVKVTIEAEEGSQLRAAFN----NGSGQWDNNQGRDYDFSS----GVHTLADGRILSGTP----