[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_01675

[Show Plain Result]

#ERROR : Can't open dsspfile "2cayB.bssp"
#ERROR : Can't open dsspfile "2cayA.bssp"
#ERROR : Can't open dsspfile "2dx5A.bssp"
#ERROR : Can't open dsspfile "1bdp-.bssp"
#ERROR : Can't open dsspfile "2bdpA.bssp"
#ERROR : Can't open dsspfile "1d9dA.bssp"

## Summary of PDB Search
:270
    2e-13  24%  2cayB  [x.x.x] VACUOLAR PROTEIN SORTING PROTEIN 36
    9e-13  24%  2cayA  [x.x.x] VACUOLAR PROTEIN SORTING PROTEIN 36
    3e-05  17%  2dx5A  [x.x.x] VACUOLAR PROTEIN SORTING PROTEIN 36
    8e-05  23%  1bdp-  [x.x.x] DNA POLYMERASE I
    2e-04  22%  2bdpA  [c.55.3 - e.8.1] PROTEIN (DNA POLYMERASE I)
    5e-04  19%  1d9dA  [c.55.3 - e.8.1] DNA POLYMERASE I
:270

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxSWVMLHETDGFVRLPNERLIYTSPLRTTISLQALNPRPGDESLSLQSS
2cayB           ----------------------HYVETTSSGQPLLREGEKDI--------FIDQSVGLYHGKSKIL-QRQ
2cayA           ----------------------HYVETTSSGQPLLREGEKDI----------FIDQSVGLYHKSKILQRQ
2dx5A           -----------------------------------EINETLVIQ---QRGVRVY----DGEEKFDA----
1bdp-           ----------------------------------------------------------------------
2bdpA           ----------------------------------------------------------------------
1d9dA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NGRVHLTNQRIVYLPVQPTPQFQSFSAPLLNLHDTFVSAPFFGPNVWSAIVQPVVGGGIPPSNTAVQVKM
2cayB           RGRIFLTSQRIIYIDDA-KPTQNSLGLELDDLAYVNYSSGFLTRSPRL-ILFFK-----DPSSSTEFVQL
2cayA           RGRIFLTSQRIIYIDDA-KPTQNSLGLELDDLAYVNYSSGFLT---RSPRLILFFKD---PSSSTEFVQL
2dx5A           -GTLLLSTHRLIWRD----QKNNECCMAIPLSQIVFIE------EQAKIVVHLHSKNSY--------IRL
1bdp-           ---------------------------------------------------------GISDYGLAQNLNI
2bdpA           -----------------------------------------------------VYGIS--DYGLAQNLNI
1d9dA           -----------------------------------------------AINFGLIYGMSAF--GLARQLNI


                         +         .         .         .         .         *         .:210
query           TFKEGGAFDFHSAFERIKERLQQVVEQARENGMISxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2cayB           SFRKSDGVLFSQATERALENI-------------------------------------------------
2cayA           SFRKSDGVLFSQATERALENILT-----------------------------------------------
2dx5A           SFKEHGQIEFYR---RLSEEMTQ-----------------------------------------------
1bdp-           SRKEAAEFRYFESFPGVKRYMENIVQEAKQKGYVT-----------------------------------
2bdpA           SRKEAAEFRYFESFPGVKRYMENIVQEAKQKGYVT-----------------------------------
1d9dA           PRKEAQKYLYFERYPGVLEYMERTRAQAKEQG--------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2cayB           ------------------------------------------------------------
2cayA           ------------------------------------------------------------
2dx5A           ------------------------------------------------------------
1bdp-           ------------------------------------------------------------
2bdpA           ------------------------------------------------------------
1d9dA           ------------------------------------------------------------