[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_02126

[Show Plain Result]

#ERROR : Can't open dsspfile "2e0tA.bssp"
#ERROR : Can't open dsspfile "2b4oA.bssp"
#ERROR : Can't open dsspfile "2c46C.bssp"
#ERROR : Can't open dsspfile "2b4pA.bssp"
#ERROR : Can't open dsspfile "2c46D.bssp"
#ERROR : Can't open dsspfile "1d5rA.bssp"
#ERROR : Can't open dsspfile "2b4pB.bssp"
#ERROR : Can't open dsspfile "2cfvA.bssp"
#ERROR : Can't open dsspfile "3bm8A.bssp"
#ERROR : Can't open dsspfile "3cm3A.bssp"
#ERROR : Can't open dsspfile "2c46B.bssp"
#ERROR : Can't open dsspfile "2bijA.bssp"
#ERROR : Can't open dsspfile "2cmcA.bssp"
#ERROR : Can't open dsspfile "2b4uA.bssp"
#ERROR : Can't open dsspfile "1c86A.bssp"
#ERROR : Can't open dsspfile "2bv5A.bssp"

## Summary of PDB Search
:598
    1e-08  27%  2e0tA  [x.x.x] DUAL SPECIFICITY PHOSPHATASE 26
    3e-08  10%  2b4oA  [x.x.x] MYO-INOSITOL HEXAPHOSPHATE PHOSPHOHYDROLASE
    4e-08  15%  2c46C  [x.x.x] MRNA CAPPING ENZYME
    1e-07  11%  2b4pA  [x.x.x] MYO-INOSITOL HEXAPHOSPHATE PHOSPHOHYDROLASE
    9e-07  12%  2c46D  [x.x.x] MRNA CAPPING ENZYME
    1e-06  19%  1d5rA  [c.45.1 - b.7.1] PHOSPHOINOSITIDE PHOSPHOTASE PTEN
    1e-06   8%  2b4pB  [x.x.x] MYO-INOSITOL HEXAPHOSPHATE PHOSPHOHYDROLASE
    4e-06  11%  2cfvA  [x.x.x] HUMAN PROTEIN TYROSINE PHOSPHATASE RECEPTOR TYPE
    6e-06  20%  3bm8A  [x.x.x] TYROSINE-PROTEIN PHOSPHATASE YOPH
    1e-05  19%  3cm3A  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE
    1e-05  11%  2c46B  [x.x.x] MRNA CAPPING ENZYME
    1e-05  11%  2bijA  [x.x.x] TYROSINE-PROTEIN PHOSPHATASE, NON-RECEPTOR TYPE
    2e-05  17%  2cmcA  [x.x.x] TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE 1
    6e-05  10%  2b4uA  [x.x.x] MYO-INOSITOL HEXAPHOSPHATE PHOSPHOHYDROLASE
    3e-04  12%  1c86A  [c.45.1] PROTEIN (PROTEIN-TYROSINE PHOSPHATASE 1B)
    0.001   9%  2bv5A  [x.x.x] TYROSINE-PROTEIN PHOSPHATASE, NON-RECEPTOR TYPE
:598

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2e0tA           ----------------------------------------------------------------------
2b4oA           ----------------------------------------------------------------------
2c46C           ----------------------------------------------------------------------
2b4pA           ----------------------------------------------------------------------
2c46D           ----------------------------------------------------------------------
1d5rA           ----------------------------------------------------------------------
2b4pB           ----------------------------------------------------------------------
2cfvA           ----------------------------------------------------------------------
3bm8A           ----------------------------------------------------------------------
3cm3A           ----------------------------------------------------------------------
2c46B           ----------------------------------------------------------------------
2bijA           ----------------------------------------------------------------------
2cmcA           ----------------------------------------------------------------------
2b4uA           ----------------------------------------------------------------------
1c86A           ----------------------------------------------------------------------
2bv5A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2e0tA           ----------------------------------------------------------------------
2b4oA           ----------------------------------------------------------------------
2c46C           ----------------------------------------------------------------------
2b4pA           ----------------------------------------------------------------------
2c46D           ----------------------------------------------------------------------
1d5rA           ----------------------------------------------------------------------
2b4pB           ----------------------------------------------------------------------
2cfvA           ----------------------------------------------------------------------
3bm8A           ----------------------------------------------------------------------
3cm3A           ----------------------------------------------------------------------
2c46B           ----------------------------------------------------------------------
2bijA           ----------------------------------------------------------------------
2cmcA           ----------------------------------------------------------------------
2b4uA           ----------------------------------------------------------------------
1c86A           ----------------------------------------------------------------------
2bv5A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2e0tA           ----------------------------------------------------------------------
2b4oA           ----------------------------------------------------------------------
2c46C           ----------------------------------------------------------------------
2b4pA           ----------------------------------------------------------------------
2c46D           ----------------------------------------------------------------------
1d5rA           ----------------------------------------------------------------------
2b4pB           ----------------------------------------------------------------------
2cfvA           ----------------------------------------------------------------------
3bm8A           ----------------------------------------------------------------------
3cm3A           ----------------------------------------------------------------------
2c46B           ----------------------------------------------------------------------
2bijA           ----------------------------------------------------------------------
2cmcA           ----------------------------------------------------------------------
2b4uA           ----------------------------------------------------------------------
1c86A           ----------------------------------------------------------------------
2bv5A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxLYLEPNEEEASKFDVVFNVAKEVNNPFSTDGPKHDTVMSVWKATLAQSNAALRGEDPDTACSELSFK
2e0tA           ----------------------------------------------------------------------
2b4oA           ----------------------------------------------------------------------
2c46C           ----------------------------------------------------------------------
2b4pA           ----------------------------------------------------------------------
2c46D           ----------------------------------------------------------------------
1d5rA           ----------------------------------------------------------------------
2b4pB           ----------------------------------------------------------------------
2cfvA           ---LSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIM------LTEYWPS
3bm8A           ----------------------------------------------------------------------
3cm3A           -------------------------------------------------------------NAMDAPSSE
2c46B           ----------------------------------------------------------------------
2bijA           -------------------------------TQGPIVSTVADFWRMVWQEHTPIIVMIEQVAYDGVEITV
2cmcA           ----------------------------------------------------------------------
2b4uA           ----------------------------------------------------------------------
1c86A           ----------------------------------------------------------------------
2bv5A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SALESLSDECPPTPKANRPEPEYIHVPWDHNSEILDDLFPLCEIIDNRISKGKRVLIHCQLGVSRSASLV
2e0tA           ----NASHSRWRGTPEAYEGLGIRYLGVAHDSPAFDMSIHFQTIHRALSQPGGKILVHCAVGVSRSATLV
2b4oA           ---------------------RYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGKTTAFM
2c46C           ---------------------KYIKLQCKGHGEC-PTTENTETFI-RLCERFELIGVHCTHGFNRTGFLI
2b4pA           ---------------------RYFRIAATNHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGRTTAFM
2c46D           ---LTNTSRFYDRNDIEKEGIKYIKLQCKGHGEC--PTTENTETFIRLCERFELIGVHCTHGFNRTGFLI
1d5rA           -----YNLCAERHYDTAKFNCRVAQYPFDHNPPQLELIKPEDLDQWLSEDDNHVAAIHCKAGKGRTGVMI
2b4pB           ---------QTEQEVAEAAGMRYFRIAATNHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGRTTAFM
2cfvA           AQDYGDITVAMTSEIVLWTIRDFTVKNIQESHPQFHFTTTDLLINFRYLVRDYPILVHCSAGVGRTGTFI
3bm8A           ----------PAQTAVSSEVTKALASLVDQTAETKRNMYESKGSSAVADDSKLRPVIHCRAGVGRTAQLI
3cm3A           VKFKYVLNLTMDKYTLPNSNINIIHIPLDDTTDISKYFDDVTAFLSKCDQRNEPVLVHSAAGVNRSGAMI
2c46B           ----------------------KLQCKGHGECPTTENTETFIRLCERFNERNELIGVHCTHGFNRTGFLI
2bijA           QKVIHTEDYRLRLISLKSGTEERDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFI
2cmcA           ----------------------YTTWPDFGVPESFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFC
2b4uA           ----------------AEAAGRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFV
1c86A           ----------------------YTTWPDFESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFC
2bv5A           ----------------------FTSWPDQKTPDPLLHLVREVEEAAQQEGPHCAPIIVHSAGIGRTGCFI


                         .         .         .         .         *         .         .:420
query           IAYGLYKNTHLDFNAVYGMVKERSCWVGPNMSLIYQLTDFRTKIRGGTITRSPADYNEAMRTAQSSHTQT
2e0tA           LAY-LMLYHHLTLVEAIKKVKDH-RGIIPNRGFLRQLLALDRRLRQG-----------------------
2b4oA           VMTDMLKN-PSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYIEQFYRYVQENRADGYQ---TPW
2c46C           CAF-LVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIE-------------------------
2b4pA           VMTDMLKN-PSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYRIVMIEQFYRYVQENRADGYQTP
2c46D           CAF-LVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPP-------------------
1d5rA           CAYLLHRLKAQEALDFYGEVRTRDKKGVTIPSQRRYV---------------------------------
2b4pB           VMT-DMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDS-----------------------------
2cfvA           AIDRLIYQIEVDVYGIVYDLRMHRPLMVQTEDQYVFLNQC------------------------------
3bm8A           GAM-CMNDSRNSQLSVEDMVSQM-----------------------------------------------
3cm3A           LAYNKESLPMLYFLYVYHSMRDLRGAFVENPSFKRQIIEK------------------------------
2c46B           CAF-LVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIE-------------------------
2bijA           ATSQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHV------------------------------
2cmcA           LADTCLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLR-----------------------------
2b4uA           TDLKNP---SVSLKDILYRQHEI-GGFYYGEFPIKTKDKDSWKT--------------------------
1c86A           LADTCLLLMDVDIKKVLLDMRKFRMGLIQTADQLRFSYLA------------------------------
2bv5A           ATSICCQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHV------------------------------


                         .         .         +         .         .         .         .:490
query           TDIEREIAHSKAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2e0tA           ----------------------------------------------------------------------
2b4oA           SVWLKSHP-AKA----------------------------------------------------------
2c46C           ----------------------------------------------------------------------
2b4pA           WSVWLKSHPAKA----------------------------------------------------------
2c46D           ----------------------------------------------------------------------
1d5rA           ----------------------------------------------------------------------
2b4pB           ----------------------------------------------------------------------
2cfvA           ----------------------------------------------------------------------
3bm8A           ----------------------------------------------------------------------
3cm3A           ----------------------------------------------------------------------
2c46B           ----------------------------------------------------------------------
2bijA           ----------------------------------------------------------------------
2cmcA           ----------------------------------------------------------------------
2b4uA           ----------------------------------------------------------------------
1c86A           ----------------------------------------------------------------------
2bv5A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2e0tA           ----------------------------------------------------------------------
2b4oA           ----------------------------------------------------------------------
2c46C           ----------------------------------------------------------------------
2b4pA           ----------------------------------------------------------------------
2c46D           ----------------------------------------------------------------------
1d5rA           ----------------------------------------------------------------------
2b4pB           ----------------------------------------------------------------------
2cfvA           ----------------------------------------------------------------------
3bm8A           ----------------------------------------------------------------------
3cm3A           ----------------------------------------------------------------------
2c46B           ----------------------------------------------------------------------
2bijA           ----------------------------------------------------------------------
2cmcA           ----------------------------------------------------------------------
2b4uA           ----------------------------------------------------------------------
1c86A           ----------------------------------------------------------------------
2bv5A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2e0tA           --------------------------------------
2b4oA           --------------------------------------
2c46C           --------------------------------------
2b4pA           --------------------------------------
2c46D           --------------------------------------
1d5rA           --------------------------------------
2b4pB           --------------------------------------
2cfvA           --------------------------------------
3bm8A           --------------------------------------
3cm3A           --------------------------------------
2c46B           --------------------------------------
2bijA           --------------------------------------
2cmcA           --------------------------------------
2b4uA           --------------------------------------
1c86A           --------------------------------------
2bv5A           --------------------------------------