[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_02186

[Show Plain Result]

#ERROR : Can't open dsspfile "2bvfA.bssp"
#ERROR : Can't open dsspfile "3e0tA.bssp"
#ERROR : Can't open dsspfile "3d2jA.bssp"
#ERROR : Can't open dsspfile "3bw7A.bssp"
#ERROR : Can't open dsspfile "3d2hA.bssp"
#ERROR : Can't open dsspfile "3d2dA.bssp"
#ERROR : Can't open dsspfile "3c0pA.bssp"
#ERROR : Can't open dsspfile "3dq0A.bssp"
#ERROR : Can't open dsspfile "1dznA.bssp"
#ERROR : Can't open dsspfile "1e0yA.bssp"
#ERROR : Can't open dsspfile "1ahuA.bssp"
#ERROR : Can't open dsspfile "1e8gA.bssp"
#ERROR : Can't open dsspfile "1e8fA.bssp"
#ERROR : Can't open dsspfile "2e1qA.bssp"
#ERROR : Can't open dsspfile "2ckjC.bssp"
#ERROR : Can't open dsspfile "2e3tB.bssp"
#ERROR : Can't open dsspfile "3bdjA.bssp"
#ERROR : Can't open dsspfile "2ckjD.bssp"
#ERROR : Can't open dsspfile "2e3tA.bssp"
#ERROR : Can't open dsspfile "2ckjB.bssp"
#ERROR : Can't open dsspfile "2ckjA.bssp"
#ERROR : Can't open dsspfile "3c0qA.bssp"
#ERROR : Can't open dsspfile "3cwcA.bssp"

## Summary of PDB Search
:567
    2e-35  19%  2bvfA  [x.x.x] 6-HYDROXY-D-NICOTINE OXIDASE
    5e-32  16%  3e0tA  [x.x.x] GLUCOOLIGOSACCHARIDE OXIDASE
    2e-31  16%  3d2jA  [x.x.x] BERBERINE BRIDGE-FORMING ENZYME
    2e-31  16%  3bw7A  [x.x.x] CYTOKININ DEHYDROGENASE 1
    1e-28  18%  3d2hA  [x.x.x] BERBERINE BRIDGE-FORMING ENZYME
    1e-28  19%  3d2dA  [x.x.x] BERBERINE BRIDGE-FORMING ENZYME
    4e-28  13%  3c0pA  [x.x.x] CYTOKININ DEHYDROGENASE 1
    2e-27  19%  3dq0A  [x.x.x] CYTOKININ DEHYDROGENASE 1
    4e-24   9%  1dznA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    5e-24   9%  1e0yA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    6e-24   9%  1ahuA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    7e-23  10%  1e8gA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    3e-22  10%  1e8fA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    4e-15   6%  2e1qA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    3e-13   6%  2ckjC  [x.x.x] XANTHINE OXIDOREDUCTASE
    1e-11   7%  2e3tB  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    1e-11   5%  3bdjA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    2e-11   7%  2ckjD  [x.x.x] XANTHINE OXIDOREDUCTASE
    2e-10   6%  2e3tA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    6e-09   9%  2ckjB  [x.x.x] XANTHINE OXIDOREDUCTASE
    3e-07   4%  2ckjA  [x.x.x] XANTHINE OXIDOREDUCTASE
    4e-07  16%  3c0qA  [x.x.x] UV ENDONUCLEASE
    6e-06  11%  3cwcA  [x.x.x] PUTATIVE GLYCERATE KINASE 2
:567

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxQAEFVTPSAVNATMKASAVVGHRQRCSYGDSCWPTEGEWQSFNASVSGHLIRTYPSAAVCHAERYDD
2bvfA           ----------------------------------------------------------------------
3e0tA           ----------------------------------------------------------------------
3d2jA           ----------------------------------------------------------------------
3bw7A           ----------------------------------------------------------------------
3d2hA           ----------------------------------------------------------------------
3d2dA           ----------------------------------------------------------------------
3c0pA           ----------------------------------------------------------------------
3dq0A           ----------------------------------------------------------------------
1dznA           -------------------------------------------------------FRPLTLPPKLSLSDF
1e0yA           ----------------------------------------------------------------------
1ahuA           ---------------------------------------------------------PLTLPPKLSLSDF
1e8gA           ----------------------------------------------------------------------
1e8fA           ----------------------------------------------------------------------
2e1qA           ---------------------------------------------QPEPTMEEIENAFQGNLCRCTGYRP
2ckjC           ---------------------------------------------QPEPTMEEIENAFQGNLCRCTGYRP
2e3tB           ---AVTTVEGIGNTQKLHPVQARSHGSQCGFCTPGVMSMYTLLRNQPEPTVEEIENAFQGNLCRCTGYRP
3bdjA           ----------------------------------------------------------------------
2ckjD           ---------------------------------------------QPEPTMEEIENAFQGNLCRCTGYRP
2e3tA           ---------------------------------------------QPEPTVEEIENAFQGNLCRCTGYRP
2ckjB           ----------------------------------------------------------------------
2ckjA           ----------------------------------------------------------------------
3c0qA           ----------------------------------------------------------------------
3cwcA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AKCTAAKENWLDSFWRTNQTGAYSAILWELGENGQCFIDSPRDAPCDQGIVPHYSVNIQSTSDIQTAVKF
2bvfA           -----------------------------------------NIWDGRHLQRPSLIARCLSAGDVAKSVRY
3e0tA           --------------------------------------------NLRVDYDPAAIAIPRSTEDIAAAVQC
3d2jA           -----------------------------------------PLFQNSLISKPSAIILPGSKEELSNTIRC
3bw7A           ---------------------------------------------------PAAVLYPSSTADLVALLSA
3d2hA           ---------------------------------------------------PSAIILPGSKEELSNTIRC
3d2dA           --------------------------------------------------KPSAIILPGSKEELSNTIRC
3c0pA           ------------------------------------------------SALPAAVLYPSSTADLVALLSA
3dq0A           ---------------------------------------------------PAAVLYPSSTADLVALLSA
1dznA           NEIQDIIRIVGSENVEVISVDGSYM--------KPTHTHDPHHVMDQDYFLASAIVAPRNVADVQSIVGL
1e0yA           --------------------------------------------------LASAIVAPRNVADVQSIVGL
1ahuA           NEIQDIIRIVGSENVEVISS---KDQIVDGSYMKPTHTHDPHHVMDQDYFLASAIVAPRNVADVQSIVGL
1e8gA           ---------------------------------KPTHTHDPTHVMDQDYFLASAIVAPRNVADVQSIVGL
1e8fA           -----------------------------------------THVMDQDYFLASAIVAPRNVADVQSIVGL
2e1qA           ILQGFRTFARDGSPSLFKPEEFTPLDPTQEPIPELLRLKDTPRKQLRFEGERVTWIQASTLKELLDLKAQ
2ckjC           ILQG---FRTFARPSLFKPEEFTPLDPTQEPIFPPELLRLKPRKQLRFEGERVTWIQASTLKELLDLKAQ
2e3tB           ILQGFRTFAKDSPSLFNPEDFKPLDPTQEPIFPPELLRLKDTPQKLRFEGERVTWIQASTMEELLDLKAQ
3bdjA           -----------------------------------------PPKQLRFEGERVTWIQASTLKELLDLKAQ
2ckjD           ILQGFRTFARPSLFKPEEFTPLDPTQEPIFPPELLRLKDT-PRKQLRFEGERVTWIQASTLKELLDLKAQ
2e3tA           ILQGFRTFAKDSPSLFNPEDFKPLDPTQEPIFPELLRLKDTPQKKLRFEGERVTWIQASTMEELLDLKAQ
2ckjB           -----------------------------------------------------------TLKELLDLKAQ
2ckjA           -----------------------------------------PRKQLRFEGERVTWIQASTLKELLDLKAQ
3c0qA           ------------------------------------------------VLRYLALANDERLWNVEEVLKA
3cwcA           ------------------------------------------------ESLSALEVATAIEQGFREIWPD


                         +         .         .         .         .         *         .:210
query           AAQKELYLTVKNTGHDHLGRSSGQGAFSLWTHNMKGREWHTSFIPKGAPQETTGIPAVTLQAGEQWLDVY
2bvfA           ACDNGLEISVRSGGHNPNGYATNDGGIVLDLRLMNSIHID--------TAGSR----ARIGGGVISGDLV
3e0tA           GLDAGVQISAKGGGHSYYGFGGEDGHLMLELDRMYRVSVD--------DNNVA----TIQGGARLGYTAL
3d2jA           IRKGSWTIRLRSGGHSYEGLSSDTPFILIDLMNLNRVSIDLES------------ETAWVESGSTLGELY
3bw7A           ANSTPGWIAFRGRGHSLMGQAFAPGGVVVNMASLGDAAAPPRINVSADGR------YVDAGGEQVWIDVL
3d2hA           IRKGSWTIRLRSGGHSYEGLSSDTPFILIDLMNLNRVSID----------LESET--AWVESGSTLGELY
3d2dA           IRKGSWTIRLRSGGHSYEGLSSDTPFILIDLMNLNRVSID----------LESET--AWVESGSTLGELY
3c0pA           ANSTPGWIAFRGRGHSLMGQAFAPGGVVVNMASLGDAAAP------PRINVSADGRYVDAGGEQVWIDVL
3dq0A           ANSTPGWIAFRGRGHSLMGQAFAPGGVVVNMASLGDAAAPPRINV------SADGRYVDAGGEQVWIDVL
1dznA           ANKFSFPLWPISIGRNSGYGGAAPRVSGSVVLDMGKNMNRVLEVNVEGAY-------CVVEPGVTYHDLH
1e0yA           ANKFSFPLWPISIGRNSGYGGAAPRVSGSVVLDMGKNMNRVLEVNVEGAY-------CVVEPGVTYHDLH
1ahuA           ANKFSFPLWPISIGRNSGYGGAAPRVSGSVVLDMGKNMNRVLEVNVEGAY-------CVVEPGVTYHDLH
1e8gA           ANKFSFPLWPISIGRNSGYGGAAPRVSGSVVLDMGKNMNRVLEVNVEGAY-------CVVEPGVTYHDLH
1e8fA           ANKFSFPLWPISIGRNSGYGGAAPRVSGSVVLDMGKNMNRVEVNVEGA--------YCVVEPGVTYHDLH
2e1qA           HPDAKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVE--------HGPDG----ISFGAACPLSIVE
2ckjC           HPDAKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVE--------HGPDG----ISFGAACPLSIVE
2e3tB           HPDAKLVVGNTEIGIEMKFKNMLFPLIVCPAWIPELNSVV--------HGPEG----ISFGASCPLSLVE
3bdjA           HPEAKLVVGNTEIGIEMKFKNQLFPMIICPAWIPELNAVE--------HGPEG----ISFGAACALSSVE
2ckjD           HPDAKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVE--------HGPDG----ISFGAACPLSIVE
2e3tA           HPDAKLVVGNTEIGIEMKFKNMLFPLIVCPAWIPELNSVVHGP------------EGISFGASCPLSLVE
2ckjB           HP--DAKLVVGNTEIGIEMKFKNMLFPMIVCPA---WIPELNSVEHGPDG-------ISFGAACPLSIVE
2ckjA           HPD----AKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHGPD--------GISFGAACPLSIVE
3c0qA           AEALGVPVVVDTLHHALNPGRLPEEALRLAFPTWRGRPVHLASQD------------PKKRPGAHAFRVT
3cwcA           ADYLKLPLADGGEGTVEAVEATAGRIVHVEVTGPLGHR---------------VNAFYGLSGDARSAFIE


                         .         .         .         +         .         .         .:280
query           RAAAENGVIVVGGSARTVXXXXXXXXXXXHSPFSHFYGLAVDNLLEVNLVDANGTPRTINQYTDPEYFYA
2bvfA           KEAAKFGLAAVTGMHPKVGFCGLALNGG-VGFLTPKYGLASDNILGATLVTATGDVIYCSDDERPELFWA
3e0tA           ELLDQGNRALSHGTAPAVGVGGHVLGGG-YGFATHTHGLTLDWLIGATVVLADASIVHVSETENADLFWA
3d2jA           YAITESSKLGFTAGWCPTVGTGGHISGGGFGMMSRKYGLAADNVVDAILIDANGAILDRQAMGEDVFWAI
3bw7A           RASLARGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITGHGEMVTCSKQLNADLFDA
3d2hA           YAITESSKLGFTAGWCPTVGTGGHISGGGFGMMSRKYGLAADNVVDAILIDANGAILDRQAMGEDV-FWA
3d2dA           YAITESSLGFTAGWCPTVGTGGHISGGGF-GMMSRKYGLAADNVVDAILIDANGAILDRQAMGEDV-FWA
3c0pA           RASLARGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITGHGEMVTCSKQLNADLFDA
3dq0A           RASLARGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITGHGEMVTCSKQLNADLFDA
1dznA           NYLEANNRDKLWLDVPSLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTGMGALPDPKRP
1e0yA           NYLEANNRDKLWLDVPSLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTGMGALPDPKRP
1ahuA           NYLEANNRDKLWLDVPDLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTGMGALPDPKRP
1e8gA           NYLEANNRDKLWLDVPDLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTGMGALPDPKRP
1e8fA           NYLEANNRDKLWLDVPDLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTGMGALPDPKRP
2e1qA           KTLVDAVAKLPAQKTEVFRGVLEQLRWFAGTASPISDLNPVFMASGAKLTLVSRGTRRTV-QMDHTFFPG
2ckjC           KTLVDAVAKLPAQKTEVF-RGVLEQLRWFAGKQVKSVASVGGNI-------ITASP-------ISDLNPV
2e3tB           SVLAEEIAKLPEQKTEVFRGVMEQLRALAGKQVIITASPISDLNPVFMASGAKLTLVSRGTRMDHTFFPG
3bdjA           KTLLEAVAKLPTQKTEVF-RGVLEQLRWFAGKQVKSVASLGGNISGTKLTIVSRGTRRTVPMDHTFFPSY
2ckjD           KTLVDAVAKLPAQKTEVFRGVLEQLRWFAGTASPISDLNPVFMASGAKLTLVSRGRRTVQ--MDHTFFPG
2e3tA           SVLAEEIAKLPEQKTEVFRGVMEQLRALAGKGNIITASPISDLNPVFMASGAKLTTRRTVRMDHTFFPGY
2ckjB           KTLVDAVAKLPAQKTEVFRGVLEQLRWFAGKQSPISDLNPVFMASGAKLTLVSRGTRRTV-QMDHTFFPG
2ckjA           KTLVDAVAKLPAQKTEVFRGVLEQLRWFAGKQVKSVALNPVFMASGAKLTLVSRGTRR--TVQMDHTFFP
3c0qA           REDWERL---------------------------------------------------------------
3cwcA           AAASG-----------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LRGGGGSAWGVITSVTYKTHPSPSHIQVGLVQFNVTNNSTLRAVIEKCLQELPSITDAGYTGYGSMNFLS
2bvfA           VRGAGPN-FGVVTEVEVQLYELPRKMLAGFITWA-PSVSELAGLLTSLLDALNEMAD--HIYPSVFVGVD
3e0tA           LRGGGGG-FAIVSEFEFNTFEAPEIITTYQVTTT-WNRKQHVAGLKALQDWAQNTMPRELSMRLEINFFG
3d2jA           R-GGGGGVWGAIYAWKIKLLPVPEKVTVFRVTKN-VAIDEATSLLHK-WQFVAEELEEDFTLSVLGGADE
3bw7A           VLGGLGQ-FGVITRARIAVEPAPARARWVRLVY--TDFAAFSADQERLTAPRSFGPMSYVEGSVFVNGFF
3d2hA           IRGGGGGVWGAIYAWKIKLLPVPEKVTVFRVTKN-VAIDEATSLLH-KWQFVAEELEEDFTLSVLGGADE
3d2dA           IRGGGGGVWGAIYAWKIKLLPVPEKVTVFRVTK-NVAIDEATSLLHK-WQFVAEELEEDFTLSVLGGADE
3c0pA           VLGGLGQ-FGVITRARIAVEPAPARARWVRLVY--TDFAAFSADQERLTAPRSFGPMSYVEGADVARIVA
3dq0A           VLGGLGQ-FGVITRARIAVEPAPARARWVRLVY-------------------------------------
1dznA           ETMFSQSNMGIVTKIGIWLMPNPGGYQSYLITLP--KDGDLKQAVDIIRPLRLGMALQNVPTIRHVLGDK
1e0yA           ETMFSQSNMGIVTKIGIWLMPNPGGYQSYLITL--PKDGDLKQAVDIIRPLRLGMALQNVPTIRH-ILLD
1ahuA           ETMGLKPEDGIVTKIGIWLMPNPRGYQSYLITL--PKDGDLKQAVDIIRPLRLGMALQNVPTIRHVLGDK
1e8gA           ETMFSQSNMGIVTKIGIWLMPNPGGYQSYLITLPKDG--DLKQAVDIIRPLRLGMALQNVPTIAAVLGDK
1e8fA           ETMFSQSNMGIVTKIGIWLMPNPGGYQSYLITLPKDGDLK--QAVDIIRPLRLGMALQNVPTIRHVLGDK
2e1qA           YRKTLLSPEEILLSIEI-PYSREGEYFS------------------------------------------
2ckjC           FMASGA-KLTLVSRGTRRTVQMDHTFFPGY----------------------------------------
2e3tB           YRKTLLRPEEILLSIEIPYSKEGEFFSAFKQAS-------------------------------------
3bdjA           RKTLLGP-EEILLSIEIPYSREDEFFSAFKQAS-------------------------------------
2ckjD           YRKTLLSPEEILLSIEIPYSREGEY--FSAFKQASRREDDIAKVTSGMRVLFK-----------------
2e3tA           RKTLLRP-EEILLSIEIPYSKEGEFFSAFKQAS-------------------------------------
2ckjB           YRKTLLSSREGEYFSAFKQASRREDDIAKVTSG-------------------------------------
2ckjA           GYR-------------------------------------------------------------------
3c0qA           ----------------------------------------------------------------------
3cwcA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GGKEPLGFGAIFIQPNGTNATFTRTFKPYYDIAKMQGVSGALANIDFPSWIEYAEVFVQDPNIATNIIDG
2bvfA           ENRAP--SVTVCVGHLGGLDIAERDIARLRGLGRTVSDSIAVRSYDEVVALNEVGSFEDGMSNLWIDREI
3e0tA           NAKDLKKILQPIMKKAGGKST-ISKLVETDWYGQINTYLYGAD-LNITYNYDVHEYFYANSLTAPRLSDE
3d2jA           KQVWLTMLGFHFGLKTVAKSTFDLLFPELGLVEEDYLEMSWGESFAYLAGLETVSQLNNRFLKFDERAFK
3bw7A           TDADVARIVALAGERNATTVYSIEATLNYDNAQELASVLGTLSYVERDVAYAAFLDRVHGEEVALNKLGL
3d2hA           KQVWLTMLGFHFGLKTVAKSTFDLLFPELGLVEEDYLEMSWGESFAYLAGLETVSQLNNRFLKFDERAFK
3d2dA           KQVWLTMLGFHFGLKTVAKSTFDLLFPELGLVEEDYLEMSWGESFAYLAGLETVSQLNNRFLKFDERAFK
3c0pA           LAGERNASIEATLNYDNATAAAAAVDQELASVLGTLSYVEGFAFQRDVAYAAFLDRVHGEEVALNKLGLW
3dq0A           ----------------------------------------------------------------------
1dznA           RSYSSRTEPLSDEELDKIAKQLNLGRWNFYGALYGPERRVLWETIKDAFSAIPGVKFYFPEDTPENSVLR
1e0yA           AAVLGDKRSYSSRTEPLSDEELDKIAKQLNLGRWNLYGPEPIRRVLWETIKDAFSAIPGVKFYFPEDTPE
1ahuA           RSYSSRTEPLSDEELDKIAKQLNLGRWNFYGALYG---PEPIRRVLWETIKDAFSAIPGVKFYFPEDTPE
1e8gA           RSYSSRTEPLSDEELDKIAKQLNLGRWNFYGALYGPIRRVLWETIKDAFSAIPGVKFYFPEDTPENSVLR
1e8fA           RSYSSRTEPLSDEELDKIAKQLNLGRWNFYGALYG---PEPIRRVLWETIKDAFSAIPGVKFYFPEDTPE
2e1qA           ----------------------------------------------------------------------
2ckjC           ----------------------------------------------------------------------
2e3tB           ----------------------------------------------------------------------
3bdjA           ----------------------------------------------------------------------
2ckjD           ----------------------------------------------------------------------
2e3tA           ----------------------------------------------------------------------
2ckjB           ----------------------------------------------------------------------
2ckjA           ----------------------------------------------------------------------
3c0qA           ----------------------------------------------------------------------
3cwcA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           SRLLTSQALLHRTRDLVDLMFEYASFGPGFNFIGKVSSAKRDETSTHPIWEQSRALLSFAANWRDDASAN
2bvfA           AMPNA--RFAEAIAGNLDKFVSEPASGGSVKLEIEG--MPFGNPKRTPARHRDAMGVLALAEWSGAAPGS
3e0tA           AIQAFVDYKFDNSSVRPGRGWWIQWDFHG---GKNSALAAVSNDETAYAHRDQLWLWQFYDSIYDYENNT
3d2jA           TKVDLTKEPLPSKAGLLERLSKEPNGFIALNGFGGQMSKISSDFTPFPHRSGTRLMVEYIVAWNQSEFMK
3bw7A           WRRSRIADFDRGVFKGILTDIVGPLIVYPLNKSMWDDGM-----SAATPSEDVFYAVSLLFSSVAPNDLA
3d2hA           TKVDLTKEPLPSKAGLLERLSKEPNGFIALNGFGQMSKISSDFTPFPHEQKKKTEFLDWLEKVYEFMKPF
3d2dA           TKVDLTKEPLPSKAGLLERLSKEPNGFIALNGFGGQMSKISSDFTPFPHRSGTRLMVEYIVAWNQSEQKV
3c0pA           RVPHPWLDFDRGVFKGILTDIVGPLIVYPLNKSMWDDGM-----SAATPSEDVFYAVSLLFSSVAPNDLA
3dq0A           ----------------------------------------------------------------------
1dznA           VRDKTMQGIPTYDELKWIDWLPNGAHLFFSPIAKVSGEDAMMVTKKRCQEAGLDFIGTFTVGMREVFNKK
1e0yA           NSVVRDKTMQGIPTYDELKWIDWLPNGAHLFFSPIAKAGLDFIGEFTVGMREMHHIVCIVFNKKDLIQKR
1ahuA           NSVLRRDKTMQGIPTYDELKWIDWLPNGAHLFFSPIAKVSGAVTKKRCQEAGLDFIGTFTVGMRENKKDL
1e8gA           VRDKTMQGIPTYDELKWIDWLPNGAHMMQYAVTKKRCQEAGLDFIGTFTVGMREMHHIVCFNKKDLIQKR
1e8fA           NSVLRRDKTMQGIPTYDELKWIDWLPNGAHLFFSPIAKVSGEVTKKRCQEAGLDFIGTFTVGMREVFNKK
2e1qA           ----------------------------------------------------------------------
2ckjC           ----------------------------------------------------------------------
2e3tB           ----------------------------------------------------------------------
3bdjA           ----------------------------------------------------------------------
2ckjD           ----------------------------------------------------------------------
2e3tA           ----------------------------------------------------------------------
2ckjB           ----------------------------------------------------------------------
2ckjA           ----------------------------------------------------------------------
3c0qA           ----------------------------------------------------------------------
3cwcA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EKRNAKLSLVEISKKLGDIVGPGGGTYVNEANPYEPDWQNVFWGEKYARLLAIKKRIDPTNLFVCNRCVG
2bvfA           EKYPELARELDAALLRAGVTTSGFGLLNNNSEVTAEMVAEVYKPEVYSRLAAVKREYDPENRF-------
3e0tA           SPYPESGFMQGFVATIEDTLPDRKGKYFNYADTTLEEAQKLYWRGNLEKLQAIKAKYDPEDVFGNVVSVE
3d2jA           PFVSKNPRLGYVNHIDLDLGGIDWGNKTVVNNAIERSWGESYFLSNYERLIRAKTLIDPNNVFNHPQSIP
3bw7A           RLQEQNRRILRFCDLAGIQYKTYLARHTD-----RSDWVRHFGAAKWNRFVEMKNKYDPKRLL-------
3d2hA           VSKNPRLG--YVNHIDLDLGGIDWGNKTVVNNAIERSWGESYFLSNYERLIRAKTLIDPNNVF-------
3d2dA           SKNPRLGYVNHIDLDLG-GIDWGNKTVVNNAIEISRSWGESYFLSNYERLIRAKTLIDPNNVF-------
3c0pA           RLQEQNRRILRFCDLAGIQYKTYLARHTD-----RSDWVRHFGAAKWNRFVEMKNKYDPKRLL-------
3dq0A           ----------------------------------------------------------------------
1dznA           DLIQKRKVQWLMRTLI-DDCAANGWGEYRTHLAFIMETYNWNNSSFLRFNEVLKNAVDPNGII-------
1e0yA           K-------VQWLMRTLIDDCAANGWGEYRTHLAFIMETYNWNNSSFLRFNEVLKNAVDPNGII-------
1ahuA           IQKRKVQWLMRTLIDDCAANGWGEYRTHLAFMDQIMETYNWNNSSFLRFNEVLKNAVDPNGIIAPGKSGV
1e8gA           KVQWLMRTLIDDCAANG---WGEYRTHLAFMDQIM-ETYNWNNSSFLRFNEVLKNAVDPNGII-------
1e8fA           DLIQKRK-VQWLMRTLIDDCAANGWGEYRTHLAFIMETYNWNNSSFLRFNEVLKNAVDPNGII-------
2e1qA           ----------------------------------------------------------------------
2ckjC           ----------------------------------------------------------------------
2e3tB           ----------------------------------------------------------------------
3bdjA           ----------------------------------------------------------------------
2ckjD           ----------------------------------------------------------------------
2e3tA           ----------------------------------------------------------------------
2ckjB           ----------------------------------------------------------------------
2ckjA           ----------------------------------------------------------------------
3c0qA           ----------------------------------------------------------------------
3cwcA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           TDxxxxx
2bvfA           -------
3e0tA           PI-----
3d2jA           PM-----
3bw7A           -------
3d2hA           -------
3d2dA           -------
3c0pA           -------
3dq0A           -------
1dznA           -------
1e0yA           -------
1ahuA           WP-----
1e8gA           -------
1e8fA           -------
2e1qA           -------
2ckjC           -------
2e3tB           -------
3bdjA           -------
2ckjD           -------
2e3tA           -------
2ckjB           -------
2ckjA           -------
3c0qA           -------
3cwcA           -------