[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_02196

[Show Plain Result]

#ERROR : Can't open dsspfile "3d3sD.bssp"
#ERROR : Can't open dsspfile "2c27A.bssp"
#ERROR : Can't open dsspfile "3d3sB.bssp"
#ERROR : Can't open dsspfile "3d3sC.bssp"
#ERROR : Can't open dsspfile "3bj8C.bssp"
#ERROR : Can't open dsspfile "3dsbA.bssp"
#ERROR : Can't open dsspfile "3d3sA.bssp"
#ERROR : Can't open dsspfile "2bueA.bssp"
#ERROR : Can't open dsspfile "3eg7E.bssp"
#ERROR : Can't open dsspfile "3eg7B.bssp"
#ERROR : Can't open dsspfile "3eg7A.bssp"
#ERROR : Can't open dsspfile "1bobA.bssp"
#ERROR : Can't open dsspfile "3d2pA.bssp"
#ERROR : Can't open dsspfile "3bj7A.bssp"
#ERROR : Can't open dsspfile "2a6aB.bssp"
#ERROR : Can't open dsspfile "2ae6C.bssp"
#ERROR : Can't open dsspfile "3eg7C.bssp"
#ERROR : Can't open dsspfile "2ae6A.bssp"
#ERROR : Can't open dsspfile "3efaA.bssp"
#ERROR : Can't open dsspfile "2cnmA.bssp"
#ERROR : Can't open dsspfile "3bj7B.bssp"
#ERROR : Can't open dsspfile "3bj8B.bssp"
#ERROR : Can't open dsspfile "3bj8A.bssp"
#ERROR : Can't open dsspfile "2b3uA.bssp"
#ERROR : Can't open dsspfile "1b6bB.bssp"
#ERROR : Can't open dsspfile "3dr6A.bssp"
#ERROR : Can't open dsspfile "3eg7F.bssp"
#ERROR : Can't open dsspfile "1cm0B.bssp"
#ERROR : Can't open dsspfile "3dr8B.bssp"
#ERROR : Can't open dsspfile "3c26A.bssp"
#ERROR : Can't open dsspfile "3d8pA.bssp"
#ERROR : Can't open dsspfile "1bo4A.bssp"
#ERROR : Can't open dsspfile "2beiA.bssp"
#ERROR : Can't open dsspfile "2beiB.bssp"
#ERROR : Can't open dsspfile "2dxqA.bssp"
#ERROR : Can't open dsspfile "1cm0A.bssp"
#ERROR : Can't open dsspfile "2bl1A.bssp"
#ERROR : Can't open dsspfile "2b3vA.bssp"
#ERROR : Can't open dsspfile "2ae6B.bssp"
#ERROR : Can't open dsspfile "2atrA.bssp"
#ERROR : Can't open dsspfile "3e0kA.bssp"
#ERROR : Can't open dsspfile "3dr6B.bssp"
#ERROR : Can't open dsspfile "1cjwA.bssp"
#ERROR : Can't open dsspfile "2b3uB.bssp"
#ERROR : Can't open dsspfile "3dr8A.bssp"
#ERROR : Can't open dsspfile "3dr6C.bssp"
#ERROR : Can't open dsspfile "1bo4B.bssp"
#ERROR : Can't open dsspfile "2ae6D.bssp"
#ERROR : Can't open dsspfile "2b5gB.bssp"

## Summary of PDB Search
:209
    2e-08  14%  3d3sD  [x.x.x] L-2,4-DIAMINOBUTYRIC ACID ACETYLTRANSFERASE
    1e-07  20%  2c27A  [x.x.x] MYCOTHIOL SYNTHASE
    2e-07  15%  3d3sB  [x.x.x] L-2,4-DIAMINOBUTYRIC ACID ACETYLTRANSFERASE
    3e-07  15%  3d3sC  [x.x.x] L-2,4-DIAMINOBUTYRIC ACID ACETYLTRANSFERASE
    4e-07  10%  3bj8C  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    4e-07  15%  3dsbA  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    4e-07  19%  3d3sA  [x.x.x] L-2,4-DIAMINOBUTYRIC ACID ACETYLTRANSFERASE
    8e-07  17%  2bueA  [x.x.x] AAC(6')-IB
    8e-07  14%  3eg7E  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    2e-06  15%  3eg7B  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    2e-06  15%  3eg7A  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    2e-06  10%  1bobA  [x.x.x] HISTONE ACETYLTRANSFERASE
    2e-06  20%  3d2pA  [x.x.x] PUTATIVE ACETYLGLUTAMATE SYNTHASE
    3e-06  11%  3bj7A  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    4e-06   9%  2a6aB  [x.x.x] HYPOTHETICAL PROTEIN TM0874
    4e-06  15%  2ae6C  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    5e-06  15%  3eg7C  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    6e-06  13%  2ae6A  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    8e-06  13%  3efaA  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    1e-05  18%  2cnmA  [x.x.x] MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN
    1e-05  14%  3bj7B  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    2e-05  11%  3bj8B  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    2e-05  11%  3bj8A  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    3e-05  11%  2b3uA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    3e-05  15%  1b6bB  [d.108.1] PROTEIN (ARYLALKYLAMINE N-ACETYLTRANSFERASE)
    4e-05  20%  3dr6A  [x.x.x] YNCA
    4e-05  15%  3eg7F  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    5e-05  20%  1cm0B  [d.108.1] P300/CBP ASSOCIATING FACTOR
    5e-05  20%  3dr8B  [x.x.x] YNCA
    6e-05  17%  3c26A  [x.x.x] PUTATIVE ACETYLTRANSFERASE TA0821
    7e-05  17%  3d8pA  [x.x.x] ACETYLTRANSFERASE OF GNAT FAMILY
    8e-05  20%  1bo4A  [d.108.1] PROTEIN (SERRATIA MARCESCENS AMINOGLYCOSIDE-3-N-
    8e-05  14%  2beiA  [x.x.x] DIAMINE ACETYLTRANSFERASE 2
    8e-05  23%  2beiB  [x.x.x] DIAMINE ACETYLTRANSFERASE 2
    8e-05  16%  2dxqA  [x.x.x] ACETYLTRANSFERASE
    1e-04  17%  1cm0A  [d.108.1] P300/CBP ASSOCIATING FACTOR
    1e-04  17%  2bl1A  [x.x.x] PUTATIVE PHOSPHINOTHRICIN N-ACETYLTRANSFERASE
    1e-04  13%  2b3vA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    1e-04  14%  2ae6B  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    2e-04  13%  2atrA  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    2e-04  14%  3e0kA  [x.x.x] AMINO-ACID ACETYLTRANSFERASE
    3e-04  19%  3dr6B  [x.x.x] YNCA
    4e-04  14%  1cjwA  [d.108.1] PROTEIN (SEROTONIN N-ACETYLTRANSFERASE)
    5e-04  14%  2b3uB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    5e-04  16%  3dr8A  [x.x.x] YNCA
    6e-04  20%  3dr6C  [x.x.x] YNCA
    6e-04  18%  1bo4B  [d.108.1] PROTEIN (SERRATIA MARCESCENS AMINOGLYCOSIDE-3-N-
    8e-04  13%  2ae6D  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    8e-04  12%  2b5gB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
:209

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d3sD           ----------------------------------------------------------------------
2c27A           ----------------------------------------------------------------------
3d3sB           ----------------------------------------------------------------------
3d3sC           ----------------------------------------------------------------------
3bj8C           ----------------------------------------------------------------------
3dsbA           ----------------------------------------------------------------------
3d3sA           ----------------------------------------------------------------------
2bueA           ----------------------------------------------------------------------
3eg7E           ----------------------------------------------------------------------
3eg7B           ----------------------------------------------------------------------
3eg7A           ----------------------------------------------------------------------
1bobA           ----------------------------------------------------------------------
3d2pA           ----------------------------------------------------------------------
3bj7A           ----------------------------------------------------------------------
2a6aB           ----------------------------------------------------------------------
2ae6C           ----------------------------------------------------------------------
3eg7C           ----------------------------------------------------------------------
2ae6A           ----------------------------------------------------------------------
3efaA           ----------------------------------------------------------------------
2cnmA           ----------------------------------------------------------------------
3bj7B           ----------------------------------------------------------------------
3bj8B           ----------------------------------------------------------------------
3bj8A           ----------------------------------------------------------------------
2b3uA           ----------------------------------------------------------------------
1b6bB           ----------------------------------------------------------------------
3dr6A           ----------------------------------------------------------------------
3eg7F           ----------------------------------------------------------------------
1cm0B           ----------------------------------------------------------------------
3dr8B           ----------------------------------------------------------------------
3c26A           ----------------------------------------------------------------------
3d8pA           ----------------------------------------------------------------------
1bo4A           ----------------------------------------------------------------------
2beiA           ----------------------------------------------------------------------
2beiB           ----------------------------------------------------------------------
2dxqA           ----------------------------------------------------------------------
1cm0A           ----------------------------------------------------------------------
2bl1A           ----------------------------------------------------------------------
2b3vA           ----------------------------------------------------------------------
2ae6B           ----------------------------------------------------------------------
2atrA           ----------------------------------------------------------------------
3e0kA           ----------------------------------------------------------------------
3dr6B           ----------------------------------------------------------------------
1cjwA           ----------------------------------------------------------------------
2b3uB           ----------------------------------------------------------------------
3dr8A           ----------------------------------------------------------------------
3dr6C           ----------------------------------------------------------------------
1bo4B           ----------------------------------------------------------------------
2ae6D           ----------------------------------------------------------------------
2b5gB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxEILLAIQNNSTSDNFYEPVHAEESHGGSVSPRKNYCCSCTYVESDVLGCAAL
3d3sD           ---------------------------------------------------------------IDGFVSA
2c27A           ----------------------------------------------------FGDSPRERPGRLLGFHWT
3d3sB           ---------------------------------------------------HTCVVAESPGGRIDGFVSA
3d3sC           ---------------------------------------------------HTCVVAESPGGRIDGFVSA
3bj8C           --------------------------------ILTEKDLQEDGFGEHPFYHCLVAEVPPEGHSIVGFAMY
3dsbA           -------------------------------------------------ERKGKYHVYTVFDKVVAQIYT
3d3sA           --------------------------------------------------------CVVAESPIDGFVSA
2bueA           ----------------------------------------------------------------------
3eg7E           ----------------------------FEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVEL
3eg7B           ----------------------------FEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVEL
3eg7A           ----------------------------FEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVEL
1bobA           ------------------------------------------------PSWQIYWLLNKKTKELIGFVTT
3d2pA           -------------------------------------------------NHISEFSILEHDGNLYGCAAL
3bj7A           ---------------------LAKYEYMEDQVILTEKDLQEDGFGEHPFYHCLVAEVPPEGHSIVGFAMY
2a6aB           ------------------------------------------------PVAPLNSFETAKSCPADGVVLV
2ae6C           -------------------------------------------------KKDETIFVAISGQQLAGFIEV
3eg7C           ----------------------------FEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVEL
2ae6A           -------------------------------------------------KKDETIFVAISGQQLAGFIEV
3efaA           ----------------------------------------------------------LQPDLPITTLRL
2cnmA           -------------------------------------------------GERYLNLKLTADDRMAAFAIT
3bj7B           ----------------------------------------------------------PEGHSIVGFAMY
3bj8B           ----------------------------------------------------------PEGHSIVGFAMY
3bj8A           ----------------------------------------------------------PEGHSIVGFAMY
2b3uA           --------------------------------DLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAYY
1b6bB           -----------------------------------------------------FIIGSLWDEERLTQESL
3dr6A           ---------------------------------------------------GYPVLVSEENGVVTGYASF
3eg7F           ----------------------------FEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVEL
1cm0B           -------------------------------------------------DPKHKTLALIKDGRVIGGICF
3dr8B           ---------------------------------------------------GYPVLVSEENGVVTGYASF
3c26A           ----------------------------------------------------------RVSGRPVATIHE
3d8pA           ----------------------------------------------------------------------
1bo4A           ---------------------------------------------------TFIALAAFDQEAVVGALAA
2beiA           --------------------------RELAEFEKLKISEEALRADGFGDNPFYHCLVAEILGPCVVGYGI
2beiB           ---------------------------------------------------NPFYHCLVAEICVVGYGIY
2dxqA           --------------------LLELYQVLNPSDPELTTQEAGAVFAALA-QPGLTIFVATENGKPVATATL
1cm0A           -------------------------------------------------DPKHKTLALIKDGRVIGGICF
2bl1A           ---------------------------------------------------YPILVASDAAGEVLGYASY
2b3vA           ----------------------------------------------------------PEGHSIVGFAYY
2ae6B           -------------------------------------------------KKDETIFVAISGQQLAGFIEV
2atrA           --------------------------------LYQAVGWTNELEQALSHS--LVIYLALDGDAVVGLIRL
3e0kA           -------------------------------------------------QEIGKFTIIEKDGLIIGCAAL
3dr6B           ---------------------------------------------------GYPVLVSEENGVVTGYASF
1cjwA           -----------------------------------------------------FIIGSLWDEERLTQESL
2b3uB           ----------------------------------------------------------------VGFAYY
3dr8A           ------------------EIYNHAVLHTAAIWNDRTVDTDNRLAWYEARQLLYPVLVSEENGVVTGYASF
3dr6C           ----------------------------------------------------------EENGVVTGYASF
1bo4B           --------------------------------TYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAA
2ae6D           -------------------------------------------------KKDETIFVAISGQQLAGFIEV
2b5gB           ------------------SDILRLIKELAYEYEEQVILTEKDEDGFFYHCLVAEVPWTPEGHSIVGFAYY


                         +         .         .         .         .         *         .:210
query           RNLPSINPLRICEIKRLYILPRARSLGYRQGAYQMQLSTRPGRKGYAEMRLDTLPTMHSAIALYKSLGF
3d3sD           Y--LLPTRPDVLFVWQVAVHSRAR--GHRLGRALGHILERQECRHVRHLETTVQASRRTFAGLAGERGA
2c27A           KVHPDHP--GLGEVYVLGVDPAAQRRGL--GQMLTSIGIVSLARVEPAVLLYVESDNVAAVRTYQSLGF
3d3sB           YLLPTRPD--VLFVWQVAVHSRAR--GHRLGRALGHILERQECRHVRHLETTVGPDNQASRRTFAGLAG
3d3sC           YLLPTRP--DVLFVWQVAVHSRAR--GHRLGRALGHILERQECRHVRHLETTVGPDNQASRRTFAGLAG
3bj8C           YFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQ-VAMKCRCSSMHFLVAEWNEPSINFYKRRGA
3dsbA           YEWSDWRNGNFLWIQSVYVDKEYRRKGIFNYLFNYIKN-ICDKDENIVGRLYVEKENINAKATYESLNY
3d3sA           YLLPTRP--DVLFVWQVAVHSRAR--GHRLGRALGHILERQECRHVRHLETTVGPDNQASRRTFAGLAG
2bueA           ---------GVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGF
3eg7E           IEINYIHR---SAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGF
3eg7B           IE---INYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGF
3eg7A           IE---INYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGF
1bobA           KYWHYIDKKFRAKISQFLIFPPYQNKGH--GSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDI
3d2pA           KTFAEAD---CGEIACLAVSPQAQDGGYGERLLA-HIIDKARGIGISRLFALSTN----TGEWFAERGF
3bj7A           YFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQ-VAMKCRCSSMHFLVAEWNEPSINFYKRRGA
2a6aB           AR---RARKGYHYCAVYLKDKGLNPLKEPSVVSDEELEEITKEF-SPKIVLKDDLLISPAVLVEESERL
2ae6C           HPPTSLAAHQKQWLLSIGVSPDFQDQGI--GGSLLSYIKDAEISGIH-KLSLRVATNQEAIRFYEKHGF
3eg7C           IE---INYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGF
2ae6A           HPPTSLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKDA---EISGIHKLSLRVATNQEAIRFYEKHGF
3efaA           EPQA-----DHVRFGRVCTRKAYRGHGW--GRQLLTAAEEWATQGFTHGEIHG---ELTAQRFYELCGY
2cnmA           QVVL-----DEATLFNIAVDPDFQRRGLGRMLLEHLID-ELETRGVVTLWLEVRASNAAAIALYESLGF
3bj7B           YFTYDPWIGKLLYLEDFFVMSDYRGFGI--GSEILKNLSQVAMKRCSSMHFLVAEWNEPSINFYKRRGA
3bj8B           YFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQ-VAMKCRCSSMHFLVAEWNEPSINFYKRRGA
3bj8A           YFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQ-VAMKCRCSSMHFLVAEWNEPSINFYKRRGA
2b3uA           FTYDPWI--GKLLYLEDFFVSDYRGFGIGSEILKNLSQVARCRCS---SHFLVAEWNEPSINFYKRRGA
1b6bB           ALHRPRG--HSAHLHALAVHRSFRQQGK--GSVLLWRYLHHVGAQPA-VRRAVLMCEDALVPFYQRFGF
3dr6A           GDWRSFDGFRYTVEHSVYVHPAHQGKGL--GRKLLSRLIDEARRCGKHVVAGIESQNAASIRLHHSLGF
3eg7F           IE---INYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGF
1cm0B           RMFPSQ---GFTEIVFCAVTSNEQVKGY--GTHLMNHLKEYHIKHDI--LNFLTYADEYAIGYFKKQGF
3dr8B           GDWRSFDGFRYTVEHSVYVHPAHQGKGL--GRKLLSRLIDEARRCGKHVVAGIESQNAASIRLHHSLGF
3c26A           K------LPDGSVLGGLRVHPEYRGSRL--GSIQETIQFLRGKT--ERLRSAVYSWNEPSLRLVHRLGF
3d8pA           ----GLIRLDNNSALKKFVDKGYRNLKI--GKKLLDKVITCKEQNIDGIYLGTIDKFISAQYFYSNNGF
1bo4A           YVLPKFEQPRSIYIYDLAVSGEHRRQGIATALINLLKH-EANALGAYVIYVQADYGDDPAVALYTKLG-
2beiA           YYFIYSTWKGRTIYLEDIYVPEYRGQGIGSKIIKK-VAEVALDKGCSQFRLAVLDWNQ-RADLYKALGA
2beiB           YFIYSTWK-GRTIYLEDIYVPEYRGQGI--GSKIIKKVAEVALDGCSQFRLAVLDWNQ-RADLYKALGA
2dxqA           LIVPNLTARPYAFIENVVTLEARRGRGY--GRTVVRHAIETAFGANCYKVLLTGRHDPAVHAFYESCGF
1cm0A           RMFPSQ---GFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHD----ILNFLTYADEYAIGYFKKQGF
2bl1A           GDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIER--ARAQGLHVVAAIESGNAASIGLHRRLGF
2b3vA           FTYDPWI--GKLLYLEDFFVSDYRGFGI--GSEILKNLSQVARCRCS-SHFLVAEWNEPSINFYKRRGA
2ae6B           HPPTSLAAHQKQWLLSIGVSPDFQDQGI--GGSLLSYIKDAEIS-GIHKLSLRVATNQEAIRFYEKHGF
2atrA           VGDGF----SSVFVQDLIVLPSYQRQGIGSSLKEALGNF------KEAYQVQLATEETEKNVGFYRSGF
3e0kA           YPYSE----ERKAEACVAIHPDYRDGNRGLLLLNYKHRSKS------ENINQIFVLTTHSLHWFREQGF
3dr6B           GDWRSFDGFRYTVEHSVYVHPAHQGKGLGRKLLSRLIDE--ARRCGKHVVAGIESQNAASIRLHHSLGF
1cjwA           ALHRPRG--HSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPA---VRRAVLMCEDALVPFYQRFGF
2b3uB           FTYDPWI--GKLLYLEDFFVSDYRGFGI--GSEILKNLSQVARCRCS-SHFLVAEWNEPSINFYKRRGA
3dr8A           GDWRSFDGFRYTVEHSVYVHPAHQGKGLGRKLLSRLIDE--ARRCGKHVVAGIESQNAASIRLHHSLGF
3dr6C           GDWRSFDGFRYTVEHSVYVHPAHQGKGL--GRKLLSRLIDEARRCGKHVVAGIESQNAASIRLHHSLGF
1bo4B           YVLPKFEQPREIYIYDLAVSGEHRRQGIATALINLLKH-EANALGAYVIYVQADYGDDPAVALYTKL--
2ae6D           HPPTSLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKDAE---ISGIHKLSLRVATNQEAIRFYEKHGF
2b5gB           FTYDPWI--GKLLYLEDFFVSDYRGFGI--GSEILKNLSQVARCRCS-SHFLVAEWNEPSINFYKRRGA