[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_02554

[Show Plain Result]

#ERROR : Can't open dsspfile "2dgyA.bssp"
#ERROR : Can't open dsspfile "1d7qA.bssp"
#ERROR : Can't open dsspfile "1ah9A.bssp"

## Summary of PDB Search
:149
    5e-23  24%  2dgyA  [x.x.x] MGC11102 PROTEIN
    2e-14  78%  1d7qA  [b.40.4] TRANSLATION INITIATION FACTOR 1A
    1e-13  27%  1ah9A  [x.x.x] INITIATION FACTOR 1
:149

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxLTFKEEGQEYAQVVKMLGNGRLEALCFDGEKRLAHIRGKLRKKVW
2dgyA           -------------------------HIVPSNQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIW
1d7qA           -------------------------LVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVW
1ah9A           ----------------------------EDNIEMQGTVLETLPNTMFRVELENGHVVTAHISGKMRKYIR


                         .         .         *         .         .         .         .:140
query           INQGDIILLSLRDYQDEKGDVILKYSADEARSLKAYGELPESAKINETDTYGHEGLDDNVEFDEDRESAD
2dgyA           IKRGDFLIVDIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEASEVAEKHNSGPS----------------
1d7qA           INTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFG-PGDDDEIQFDDIGD--D
1ah9A           ILTGDKVTVELTPYDLSKGRIVFRS---------------------------------------------


                         +         .         .         .         .         *         .:210
query           EKDIDxxxx
2dgyA           ---------
1d7qA           DEDID----
1ah9A           ---------