[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_02566

[Show Plain Result]

#ERROR : Can't open dsspfile "2eepA.bssp"
#ERROR : Can't open dsspfile "2c7bB.bssp"
#ERROR : Can't open dsspfile "2c7bA.bssp"
#ERROR : Can't open dsspfile "3be8A.bssp"
#ERROR : Can't open dsspfile "2d81A.bssp"
#ERROR : Can't open dsspfile "3bl8C.bssp"
#ERROR : Can't open dsspfile "3ccbA.bssp"
#ERROR : Can't open dsspfile "3be8B.bssp"
#ERROR : Can't open dsspfile "3eblF.bssp"
#ERROR : Can't open dsspfile "1a7uA.bssp"
#ERROR : Can't open dsspfile "3dl7A.bssp"
#ERROR : Can't open dsspfile "1c2bA.bssp"
#ERROR : Can't open dsspfile "3bl8D.bssp"
#ERROR : Can't open dsspfile "3d3nB.bssp"
#ERROR : Can't open dsspfile "3dyvA.bssp"
#ERROR : Can't open dsspfile "3ed1B.bssp"
#ERROR : Can't open dsspfile "3dkrA.bssp"
#ERROR : Can't open dsspfile "3bl8B.bssp"
#ERROR : Can't open dsspfile "3bixA.bssp"
#ERROR : Can't open dsspfile "3ds8A.bssp"
#ERROR : Can't open dsspfile "2cutA.bssp"
#ERROR : Can't open dsspfile "3bjrA.bssp"
#ERROR : Can't open dsspfile "2dfpA.bssp"
#ERROR : Can't open dsspfile "3b3qA.bssp"
#ERROR : Can't open dsspfile "3e3aB.bssp"
#ERROR : Can't open dsspfile "3eblE.bssp"
#ERROR : Can't open dsspfile "3eblC.bssp"
#ERROR : Can't open dsspfile "3bl8A.bssp"
#ERROR : Can't open dsspfile "2bceA.bssp"
#ERROR : Can't open dsspfile "1be0A.bssp"
#ERROR : Can't open dsspfile "1b6gA.bssp"
#ERROR : Can't open dsspfile "1broA.bssp"
#ERROR : Can't open dsspfile "1cuxA.bssp"
#ERROR : Can't open dsspfile "3b5eB.bssp"

## Summary of PDB Search
:287
    4e-08  13%  2eepA  [x.x.x] DIPEPTIDYL AMINOPEPTIDASE IV, PUTATIVE
    4e-08  14%  2c7bB  [x.x.x] CARBOXYLESTERASE
    5e-08  14%  2c7bA  [x.x.x] CARBOXYLESTERASE
    1e-06  13%  3be8A  [x.x.x] NEUROLIGIN-4, X-LINKED
    2e-06  11%  2d81A  [x.x.x] PHB DEPOLYMERASE
    2e-06  14%  3bl8C  [x.x.x] NEUROLIGIN-2
    3e-06  13%  3ccbA  [x.x.x] DIPEPTIDYL PEPTIDASE 4
    4e-06  11%  3be8B  [x.x.x] NEUROLIGIN-4, X-LINKED
    4e-06   7%  3eblF  [x.x.x] GIBBERELLIN RECEPTOR GID1
    6e-06  10%  1a7uA  [c.69.1] CHLOROPEROXIDASE T
    1e-05  12%  3dl7A  [x.x.x] ACETYLCHOLINESTERASE
    2e-05  12%  1c2bA  [c.69.1] ACETYLCHOLINESTERASE
    3e-05  13%  3bl8D  [x.x.x] NEUROLIGIN-2
    3e-05  11%  3d3nB  [x.x.x] PUTATIVE LIPASE/ESTERASE
    4e-05  15%  3dyvA  [x.x.x] ESTERASE D
    6e-05  10%  3ed1B  [x.x.x] GIBBERELLIN RECEPTOR GID1
    1e-04  17%  3dkrA  [x.x.x] ESTERASE D
    1e-04  13%  3bl8B  [x.x.x] NEUROLIGIN-2
    1e-04  16%  3bixA  [x.x.x] NEUROLIGIN-1
    1e-04  13%  3ds8A  [x.x.x] LIN2722 PROTEIN
    1e-04  12%  2cutA  [x.x.x] CUTINASE
    2e-04  11%  3bjrA  [x.x.x] PUTATIVE CARBOXYLESTERASE
    2e-04   9%  2dfpA  [c.69.1] PROTEIN (ACETYLCHOLINESTERASE)
    2e-04  13%  3b3qA  [x.x.x] NLGN1 PROTEIN
    2e-04  26%  3e3aB  [x.x.x] POSSIBLE PEROXIDASE BPOC
    2e-04  10%  3eblE  [x.x.x] GIBBERELLIN RECEPTOR GID1
    2e-04  11%  3eblC  [x.x.x] GIBBERELLIN RECEPTOR GID1
    3e-04  12%  3bl8A  [x.x.x] NEUROLIGIN-2
    4e-04  15%  2bceA  [x.x.x] CHOLESTEROL ESTERASE
    4e-04  14%  1be0A  [c.69.1 (1cijA)] HALOALKANE DEHALOGENASE
    5e-04  14%  1b6gA  [x.x.x] HALOALKANE DEHALOGENASE
    7e-04  26%  1broA  [c.69.1] BROMOPEROXIDASE A2
    7e-04  18%  1cuxA  [x.x.x] CUTINASE
    8e-04  16%  3b5eB  [x.x.x] MLL8374 PROTEIN
:287

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxMEAENRTFPDLHIVEPQAPHTHTAIFLHGRGSNGPEFTEDLFSSKTSGGQDLPSLFPSWRWVFPSS
2eepA           ----------------------------------------------------------------------
2c7bB           ----------------------------------------------------------------------
2c7bA           ----------------------------------------------------------------------
3be8A           ----------------------------------------------------------------------
2d81A           ----------------------------------------------------------------------
3bl8C           ----------------------------------------------------------------------
3ccbA           --------------------------------------------------DVYAGPCSQKADTVFRLNWA
3be8B           ---------------NIYVPTESKKPVMVYIHGGS-----YMEGTGNMIDGSILASYGNVIVITINYRLG
3eblF           ------------NILRRADGTFERDLGEYLDRRVPANARPLEGVSSFDHIIDQSVVRIYRAAFPVIIFFH
1a7uA           ----ITVGQENSTSIDLYYEDHGAGQPVVLIHGFPLSG-HSWERQSAALLD--AGYRVITYDRRGFGQSS
3dl7A           ----------------------------------------------------------------------
1c2bA           -------------------RPASPTPVLIWIYGGGYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGF
3bl8D           ----------------------------------------------------------------------
3d3nB           ----------------------------------------------------------------------
3dyvA           --------------------------GVVLLHAYTGSPNDMNFRALQR-----SGYGVYVPLFSG-HGTV
3ed1B           ----------------------------------------------------------------------
3dkrA           ----------------------------------------------------------------------
3bl8B           ----------------------------------------------------------------------
3bixA           ----------------------------------------------------------------------
3ds8A           ----------------------------ILIHGSGGNASSLDKADQLNEYRS-------SNEALTTVNSE
2cutA           --------------LINGNSASCADVIFIYARGSTETGNLGTLGPSIASNLESAFGKDGVWIQGVGGAYR
3bjrA           ----------------------------------------------------------------------
2dfpA           --------------------------------------------------------STLDVYNGKYLAYT
3b3qA           ----------------------------------------------------------------------
3e3aB           ----------------------------------------------------------------------
3eblE           ----------------------------------------------------------------------
3eblC           ----------------------------------------------------------------------
3bl8A           -----------TEDGPLTKKDSGKKPVMLFLHGGSYMEGTG-NMFDGSVLAAYGNVIVVTLNYRLGVLGF
2bceA           ----------------------------------------------------------------------
1be0A           ----------------------------------------------------------------------
1b6gA           ----------------------------------------------------------------------
1broA           ----------------------------------------------------------------------
1cuxA           ----------TRDDLINGNSASCADVIFIYARGSTETG-----NLGTLGPSIASNLESAFGKDGVWIQGV
3b5eB           -------ENSPLLTYRLLGAGKESRECLFLLHGSGVDETTLVPLA--------RRIAPTATLVAARGRIP


                         .         .         *         .         .         .         .:140
query           GSRWNATFMEHQSAWFDIASLADTNRRQDLQIQGLKESSQYVLGVIEREIELLGGRSDNIIFGGLSQGMA
2eepA           ----------------------------------------------------------------------
2c7bB           ----------------------------------------AALKWVADRADELGVDPDRIAVAGDSAGGN
2c7bA           ----------------------------------------AALKWVADRADELGVDPDRIAVAGDSAGGN
3be8A           -----------------------------------------ALRWIEENVGAFGGDPKRVTIFGSGAGAS
2d81A           -------------------------------------------------LPAFNVNPNSVSVSGLASGGY
3bl8C           -----------------------------------------ALRWLSENIAHFGGDPERITIFGSGAGAS
3ccbA           TYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGY
3be8B           ILGFLSTGDQAAKGNYGLLDQIQ------------------ALRWIEENVGAFGGDPKRVTIFGSGAGAS
3eblF           GGSFVHSSASSTIYDSLCRRFVKLSKGVVVSVNYRRAPEHAYDDGWTALKWVMSQPFMRARVFLSGDSSG
1a7uA           QPTTGYDYDTFAADLNTV--LETLDLQDAVLVGFSMGTGEVARYVSSYGTARIAKVAFLASLEPFLLKTD
3dl7A           -----------------------------------------ALQWVQENIAAFGGDPMSVTLFGEAGAAS
1c2bA           LALPGSREAPGNVGLLDQRLALQ---------------------WVQENIAAFGGDPMSVTLFGESAGAA
3bl8D           ---------------------------------------------LSENIAHFGGDPERITIFGSGAGAS
3d3nB           ---------------------------------------------------------QRIILAGFSAGGH
3dyvA           EPLDILTKGNPDIWWAESSAAVA----------------------------HMTAKYAKVFVFGLSLGGI
3ed1B           ---------------------------------------------------------ARVFLSGDSSGGN
3dkrA           -----------------------------------------------------------VFVFGLSLGGI
3bl8B           -----------------------------------------ALRWLSENIAHFGGDPERITIFGSGAGAS
3bixA           ---------------------------------------IQALRWTSENIGFFGGDPLRITVFGSGAG-G
3ds8A           GKIKFEGKLTKDAKRPIIKFGFEQNQATPDDW-------SKWLKIAEDLKSRYGFT---QDGVGHSNGGL
2cutA           ATLG-DNALPRGTSSAAIREMLG---------------------LFQQANTKCPD--ATLIAGGYSQGAA
3bjrA           ---------------------------------------------------------QQITPAGFSVGGH
2dfpA           EEVVLVSLSYRVGAFGFLALHGSQEAPGNVGLLDQRM----ALQWVHDNIQFFGGDPKTVTIFGEAGGAS
3b3qA           --------------------------------------------WTSENIGFFGGDPLRITVFGSGAGGS
3e3aB           ----------------------------------------------------------------------
3eblE           -----------------------------------------------------------FLSGDSSGGNI
3eblC           ---------------------------------------------------------ARVFLSGDSSGGN
3bl8A           LSTGDQAAKGNYGLLDQIQALR----------------------WLSENIAHFGGDPERITIFGSGAGAS
2bceA           ---------------------------------------------VKRNIEAFGGDPDQITLFGESAGGA
1be0A           ----------------------------------------------------------------------
1b6gA           ----------------------------------------------------------------------
1broA           ----------------------------------------------------------------------
1cuxA           GGAYRATLGDNALPRGTSSAAIREMLGLF-------------------QQANTKCPDATYIAGGYSQGAA
3b5eB           QEDGFRWFERIDPTRFEQKSI-------------LAETAAFA-AFTNEAAKRHGLNLDHATFLGYSNGAN


                         +         .         .         .         .         *         .:210
query           TALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFD
2eepA           -GVDFLKSQSWVDADRIGVHGWSYGGFMTTNLMLTHGDVFKVGVAGGPVIDWNRYEIMYGERYFDAPQEN
2c7bB           LAAVVSILDRNSGEKLVKKQVLIYPVVNTGVPTASLVEFGV-AETTSLPIELVWFGRQYLKRPEEAYDFK
2c7bA           LAAVVSILDRNSGEKLVKKQVLIYPVVNTGVPTASLVEFGVAETTSLPIE-LVWFGRQYLKRPEEAYDFK
3be8A           CVSLLTLSHYS----EGLFQKAIIQSGTALSSWAVNYQ------------PAKYTRILADKVGCNMLDTT
2d81A           MAAQLGVAYSDVFNVGFGVFAGGPYDCARNQYYTSCMYNGYPSITT--------------PTANMKSWSG
3bl8C           CVNLLILSHHS----EGLFQKAIAQSGTAISSWSVNYQ------------PLKYTRLLAAKVGCDREDST
3ccbA           VTSMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTV----------------
3be8B           CVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRILADKVGCNMLDTTDMVECLRN--------
3eblF           GNIAHHVAVRAADEGVKVCGNILLNAMFGGTERTESERRLDGKYFVTLQDRDWYWKAYLPEDADRDHPNP
1a7uA           DNPDGAAPKEFFDGIVAAVKADRYAFYTG-FFNDFYNLDENLGTRISEEAVRNSWNTAFFAAAAAPTTWY
3dl7A           VGMHILSLPSRSLFHRA-VLQSGTPNGPWATVSAGEARRRATLLARLVGCPNDTELIACLRTRPA-QDLV
1c2bA           SVGMHILSLP----SRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGACLRTRPAQDLV
3bl8D           CVNLLILSHHSEGLFQKAIAQSGTAISSWSVN----------------YQPLKYTRLLAAKVGCDREDST
3d3nB           VVATYNGVATQ----PELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQIT-------TDARL
3dyvA           FAMKALETLPGITAGGV--FSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFA
3ed1B           IAHHVAVRAADEGVKVCGNILLNAMFGGTERTESERRLDGKYFVTLQDRDWYWKAYLPEDADRDHPACNP
3dkrA           FAMKALETLPGITA--GGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFA
3bl8B           CVNLLILSHHSEGLFQKAIAQSGTAISSWSVNYQP----------------LKYTRLLAAKVGCDREDST
3bixA           SCVNLLTLSHYSEKGLFQRAIAQSGTALSSWAVSFQPAKYARILATKVGCNVSDTV--------------
3ds8A           ALTYYAEDYAGDKVPTLRKLVAIGSPFNDLDPNDNGDLSFK-------------KLPNSTPQDYFIKNQT
2cutA           LAAASIEDLDSAIRDKIAGTVLFGYTKNLQ----------------------------------------
3bjrA           IVALYNDYWATRVATELN-VTPALKPNNVVLGYPVISPLLGFTWTPT--------------------PNE
2dfpA           VGMHILSPGSRDLFRRA-ILQSGSPNCPWASVSVAEGRRRAVELGRNLNCNLN--SDEELIHCLREKKPQ
3b3qA           CVNLLTLSHYSEGLFQRAIAQSGTALSSWAVSFQPAKYARILATKVGCQVSDTVELVECLQK--------
3e3aB           ----------------------------------------------------------------------
3eblE           AHHVAVRAADEGVKVCGNILLNAMFGGTERTESERRLDGKYFVTLQDRDWYWKAYLPEDADRDHPACNPF
3eblC           IAHHVAVRAADEGVKVCGNILLNAMFGGTERTESERRLDGKYFVTLQDRDWYWKAYLPEDADRDHPACNP
3bl8A           CVNLLILSHHSEGLFQKAIAQSGTAISSWSVNYQPLKYTRLLAAKVGCDREDSTEAVECLRR--------
2bceA           SVSLQTLSPYNKGLIKRAISQSGVGLCPWAIQQDPLFWAKRIAEKVGCPVDDTSKMAGCLKITDPLTLAY
1be0A           ----------------------------------------------------------------------
1b6gA           ----------------------------------------------------------------------
1broA           ----------------------------------------------------------------------
1cuxA           LAAASIEDLDSAIRDKIAGTVLFGYTKNLQ----------------------------------------
3b5eB           LVSSLLLHPGIVRLAAL------------------------------------------LRPPVLDHVPA


                         .         .         .         +         .         .         .:280
query           SKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQACQLLKEMGMDVKFYEYSGAENEGHWIKEPDGFDQIAA
2eepA           PELLKRAGDLKGRLMLIHGAIDPVVVWQHSLLFLDACVKARTYPDYYVYPSHEHNVMGPDRVHLYETITR
2c7bB           ASPLLADLGGLPPALVVTAEYDPLRDE---GELYAYKKASGSRAVAVRF---AGVHGFVAGREALDLAAA
2c7bA           ASPLLADLGGLPPALVVTAEYDPLRDE---GELYAYKKASGSRAVAVRF---AGVHGFVAGREALDLAAA
3be8A           DMVECLRNK-NYKELIQQTITPATYHIAFGQILMEQGEFLNYDIMLGVN---QGEGLK------------
2d81A           NQIASVANLGQRKIYMWTGSSDTTVGPNVMNQLKAQLGNFDANVSYVTTTGAVHTFPTDFNGAGDNSCSL
3bl8C           EAVECLRRK-SSRELVDQDVQPARYHIAFGEILMQQGEFLNYDMLIGVN---QGEGLKFVEDS-------
3ccbA           --MSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDVGVDFQAMWY---TDEDHGIASSTAYTHMSH
3be8B           ---------KNYKELIQQTITPATYHIAFGDDPQILMEQGEFLNYDIMLGVNQGEGLK------------
3eblF           FGPNGRRLGGLPFAKSLIIVSGLDLTCDRQLAYADALREDGHHVKVVQC---ENATVGFYLLPNTVHYHE
1a7uA           TDFRADIPRIDVPALILHGTGDRTLPI---ENTARVFHKALPSAEYVEVEGA---PHGWTHAEEVTALLA
3dl7A           DHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDLQVLVGVV---KDEGSY------------
1c2bA           DHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDLQVLVGVVKD---EGSYFLVYGVPGFSK-
3bl8D           EAVECLRRK-SSRELVDQDVQPARYHIAFGEILMQQGEFLNYDMLIGVNQG---EGLKF-----------
3d3nB           WAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQALQH-QVATAYHLFGSG---IHYLNDAIWPQLALR
3dyvA           TTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALIN-AARVDFHWYDDA---KHVISAHHALEDVIA
3ed1B           FGPNGRRLGGLPFAKSLIIVSGLDLTCDRQLAYADALREDGHHVKVVQC---ENATVGFYLLPNTVHYHE
3dkrA           TTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALIN-AARVDFHWYDDAKHVITVNSAHHALEDVIA
3bl8B           EAVECLRRK-SSRELVDQDVQPARYHIAFGEILMQQGEFLNYDMLIGVN---QGEGLK------------
3bixA           ELVECLQKK-PYKELVDQDVQPARYHIAFGDDPQILMEQGEFLNYDIMLGVNQGEGLK------------
3ds8A           EVSPDLEVLAIAGELSEDNPTDGIVPTISSLATRLFPGSKAYIEDIQVGEDA---VHQHETPKSIEKTYW
2cutA           ----------------------------------------------------------------------
3bjrA           LAADQHVNSDNQPTFIWTTADDPIVPATNTLAYATALATAKIPYELHVFKHG---PHGLALANALTLALE
2dfpA           ELIDVEWNFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGVN---KDEGSFF-----------
3b3qA           ---------KPYKELVDQDVQPARYHIAFGQILMEQGEFLNYDIMLGVN---QGEGLKF-----------
3e3aB           ---------IAAPVLVIGFADDVVTPPYLGREVADALP----NGRYLQIPDA---GHLFERPEAVTAMLK
3eblE           GPNGRRLG-GLPFAKSLIIVSGLDLTCDRQLAYADALREDGHHVKVVQC---ENATVGFYLLPNTVHYHE
3eblC           FGPNGRRLGGLPFAKSLIIVSGLDLTCDRQLAYADALREDGHHVKVVQC---ENATVGTVHYHEVEEISD
3bl8A           ---------KSSRELVDQDVQPARYHIAFG----------------------------------------
2bceA           KLPLGSTEYPKLHYLSFVPVIDGDFIPDDPVNLYANAADVDYIAGTNDMDGHLFVGMDVPAINSN-----
1be0A           ------------QTFMAIGMKDKLLGP---DVMYPMKALINGCPEPLEIADA---GHFVFGEQVAEALKH
1b6gA           ----------NGQTFMAIGMKDKLLGP---DVMYPMKALINGCPEPLEIADA---GHFVFGEQVAEALKH
1broA           ---------IDVPALILHGTGDRTLPI---ENTARVFHKALPSAEYVEVEGA---PHGLTHAEEVTALLA
1cuxA           ----------------------------------------------------------------------
3b5eB           TDLAG------IRTLIIAGAADETYGPFVPALV-TLLSRHGAEVDARIIPS----GHDI-GDPDAAIVRQ


                         .         *         .         .         .         .         +:350
query           FLESKxx
2eepA           YFT----
2c7bB           SIR----
2c7bA           SIR----
3be8A           -------
2d81A           STS----
3bl8C           -------
3ccbA           FIK----
3be8B           -------
3eblF           VME----
1a7uA           FLA----
3dl7A           -------
1c2bA           -------
3bl8D           -------
3d3nB           WLQ----
3dyvA           FMQ----
3ed1B           VME----
3dkrA           FMQ----
3bl8B           -------
3bixA           -------
3ds8A           FLE----
2cutA           -------
3bjrA           WLA----
2dfpA           -------
3b3qA           -------
3e3aB           FFAS---
3eblE           VME----
3eblC           FLNA---
3bl8A           -------
2bceA           -------
1be0A           FAETE--
1b6gA           FAETE--
1broA           FLA----
1cuxA           -------
3b5eB           WL-----