[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_02911

[Show Plain Result]

#ERROR : Can't open dsspfile "1bw0B.bssp"

## Summary of PDB Search
:537
    4e-04  23%  1bw0B  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
:537

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bw0B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bw0B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bw0B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bw0B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bw0B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHVSEAPPSPQKATRSISDFFKPNPPPPAIQEEKEN
1bw0B           -----------------------------------NHAGLVFNP---IRTVSDNAKPSPSPKPI---IKL


                         .         .         +         .         .         .         .:490
query           TGSSPKPPSLLRSHSDIEALAQPTESTTLLSNPAPPHRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bw0B           SVGDPTLDKNLLTSAAIKKLKE--AIDSQECNGYFPTV--------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bw0B           -----------------------------------------------