[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_02920

[Show Plain Result]

#ERROR : Can't open dsspfile "1bwnB.bssp"
#ERROR : Can't open dsspfile "1btkA.bssp"
#ERROR : Can't open dsspfile "1b55A.bssp"
#ERROR : Can't open dsspfile "2efrA.bssp"
#ERROR : Can't open dsspfile "2efrB.bssp"
#ERROR : Can't open dsspfile "1bwnA.bssp"
#ERROR : Can't open dsspfile "1btkB.bssp"
#ERROR : Can't open dsspfile "1b55B.bssp"
#ERROR : Can't open dsspfile "2dtcA.bssp"
#ERROR : Can't open dsspfile "2dynA.bssp"
#ERROR : Can't open dsspfile "2dtcB.bssp"
#ERROR : Can't open dsspfile "2dhjA.bssp"
#ERROR : Can't open dsspfile "1dynA.bssp"

## Summary of PDB Search
:1547
    9e-06  13%  1bwnB  [b.55.1] BRUTON'S TYROSINE KINASE
    1e-05  12%  1btkA  [b.55.1] BRUTON'S TYROSINE KINASE
    3e-05  12%  1b55A  [b.55.1] TYROSINE-PROTEIN KINASE BTK
    3e-05  20%  2efrA  [x.x.x] GENERAL CONTROL PROTEIN GCN4 AND TROPOMYOSIN 1
    4e-05  20%  2efrB  [x.x.x] GENERAL CONTROL PROTEIN GCN4 AND TROPOMYOSIN 1
    4e-05  12%  1bwnA  [b.55.1] BRUTON'S TYROSINE KINASE
    8e-05  12%  1btkB  [b.55.1] BRUTON'S TYROSINE KINASE
    2e-04  15%  1b55B  [b.55.1] TYROSINE-PROTEIN KINASE BTK
    2e-04  15%  2dtcA  [x.x.x] RAL GUANINE NUCLEOTIDE EXCHANGE FACTOR RALGPS1A
    4e-04  13%  2dynA  [b.55.1] DYNAMIN
    8e-04  16%  2dtcB  [x.x.x] RAL GUANINE NUCLEOTIDE EXCHANGE FACTOR RALGPS1A
    8e-04  11%  2dhjA  [x.x.x] RHO GTPASE ACTIVATING PROTEIN 21
    0.001  13%  1dynA  [b.55.1] DYNAMIN
:1547

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxEEAIKALTLEKSHLELEAEGFTQRLRALDESEQRYKDENWSLETQTHDLLAAAKEASDRESRLT
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           ------EDKVEELLSKNYHLENEVARLKKLLERAEERAELSEGKSAELEEELKTVTNNLKSLEAQAEKYS
2efrB           ------EDKVEELLSKNYHLENEVARLKKLLERAEERAELSEGKSAELEEELKTVTNNLKSLEAQAEKYS
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SNLNALTVEKNNIQRELDELKQANGRLVEENMATQKALDSELHILRRNITLGESERNALQQKVDELAGQN
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           QKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKDLEDELYAQKLKYKAISEEMKQLEDKVEELLSKN
2efrB           QKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKDLEDELYAQKLKYKAISEEMKQLEDKVEELLSKN
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           QELAKAVAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           YHLENEVA--------------------------------------------------------------
2efrB           YHLENEVA--------------------------------------------------------------
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTQTMIGEFL
1bwnB           -------------------------------------------------------------AAVILESIF
1btkA           --------------------------------------------------------------------IF
1b55A           --------------------------------------------------------------------IF
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           --------------------------------------------------------------------IF
1btkB           --------------------------------------------------------------------IF
1b55B           --------------------------------------------------------------------IF
2dtcA           --------------------------------------------------------------------TL
2dynA           --------------------------------------------------------------------WL
2dtcB           --------------------------------------------------------------------TL
2dhjA           --------------------------------------------------------------------WL
1dynA           --------------------------------------------------------------------WL


                         .         .         .         *         .         .         .:1330
query           WKYTRKLGRSDMSNTRHQRYFWVNPYTRTLYWGPHDPQVLAKSQQRSKSVAIEAVRVVNDDNPYPPGLHR
1bwnB           LKRSQQKKKTSPLN-FKKRLFLLTVHKLSYYKYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQI
1btkA           LKRSQQKKKTSPLN-FKKCLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQI
1b55A           LKRSQQKKKTSPLNF-KKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQI
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           LKRSQQKKKTSPLN-FKKRLFLLTVHKLSYYKYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQI
1btkB           LKRSQQKKKTSPLNFK-KCLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQI
1b55B           LKRSQQKKKTSPLN-FKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQI
2dtcA           LKEGRKPALSSW----TRYWVVLSGATLLYYGAKSLRGTD-RKHYKSTPGKKVSIVGWVQLPDDPEHPDI
2dynA           TINNIGIMKG----GSKEYWFVLTA--ENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFN
2dtcB           LKEGRKPALSSW----TRYWVVLSGATLLYYGAKSLRGTDRKHYKSTPGKKVSIVGWVQLPDDPEHPDI-
2dhjA           HFRPLVTDVGGSIRPWKQMYVVLRGHS--LYLYKDKREQTTPSEEEQPISVNACLIDISYSETKRKNVFR
1dynA           TINNIGIMKG----GSKEYWFVLTA--ENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFN


                         .         +         .         .         .         .         *:1400
query           KSLEIITPGRTLKFTAATSQRHETWFNALSYLLLRTADDETEEQDVVWEAGSDYNATNGRNSRQAESRRS
1bwnB           EMEQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQ------------------
1btkA           MEQIVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQ---YLCCSQTAKNAMGCQ
1b55A           PRRQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHP---CFWIDGQYLCCSQTAKNAMGCQ
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           PRRGVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHP---CFWIDGQYLCCSQTAKNAMGCQ
1btkB           PRRQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQ---YLCCSQTAKNAMGCQ
1b55B           SEMEVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQ------------------
2dtcA           FQLNNPDKGNVYKFQTGSRFHAILWHKHLD----------------------------------------
2dynA           TEQRNVKDYRQLELACETQEEVDSWKASF-----------------------------------------
2dtcB           FQLNNPDKGNVYKFQTGSRFHAILWHKHLD----------------------------------------
2dhjA           L----TTSDCECLFQAEDRDDMLAWIKTIQ----------------------------------------
1dynA           TEQRNVYDYRQLELACETQEEVDSWKASF-----------------------------------------


                         .         .         .         .         +         .         .:1470
query           ISSHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bwnB           ----------------------------------------------------------------------
1btkA           ILEN------------------------------------------------------------------
1b55A           ILEN------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           ILEN------------------------------------------------------------------
1btkB           ILEN------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bwnB           ----------------------------------------------------------------------
1btkA           ----------------------------------------------------------------------
1b55A           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
1bwnA           ----------------------------------------------------------------------
1btkB           ----------------------------------------------------------------------
1b55B           ----------------------------------------------------------------------
2dtcA           ----------------------------------------------------------------------
2dynA           ----------------------------------------------------------------------
2dtcB           ----------------------------------------------------------------------
2dhjA           ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           xxxxxxx
1bwnB           -------
1btkA           -------
1b55A           -------
2efrA           -------
2efrB           -------
1bwnA           -------
1btkB           -------
1b55B           -------
2dtcA           -------
2dynA           -------
2dtcB           -------
2dhjA           -------
1dynA           -------