[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_02989

[Show Plain Result]

#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "3cd9A.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "3e0cA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "1delA.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "2b0lB.bssp"
#ERROR : Can't open dsspfile "2c9oA.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "2bnlB.bssp"
#ERROR : Can't open dsspfile "2bnlA.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "2c9oB.bssp"
#ERROR : Can't open dsspfile "3c94A.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "2bnlC.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "3cb9A.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "3cddA.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "1agpA.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "2a5fA.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "1delB.bssp"
#ERROR : Can't open dsspfile "2bwjF.bssp"
#ERROR : Can't open dsspfile "3cddB.bssp"
#ERROR : Can't open dsspfile "2bwjC.bssp"
#ERROR : Can't open dsspfile "3dzvA.bssp"
#ERROR : Can't open dsspfile "2dx7A.bssp"
#ERROR : Can't open dsspfile "3dsrB.bssp"
#ERROR : Can't open dsspfile "2dwuB.bssp"
#ERROR : Can't open dsspfile "1dapA.bssp"
#ERROR : Can't open dsspfile "3cddE.bssp"
#ERROR : Can't open dsspfile "2dfsA.bssp"
#ERROR : Can't open dsspfile "2bwjE.bssp"
#ERROR : Can't open dsspfile "3ci2A.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "2ch0A.bssp"
#ERROR : Can't open dsspfile "1eg7B.bssp"
#ERROR : Can't open dsspfile "3a25A.bssp"
#ERROR : Can't open dsspfile "3cr8B.bssp"
#ERROR : Can't open dsspfile "3cmwA.bssp"
#ERROR : Can't open dsspfile "2afiM.bssp"
#ERROR : Can't open dsspfile "2ak3A.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1akyA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "3cd9A.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "1delA.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "2b0lB.bssp"
#ERROR : Can't open dsspfile "2c9oA.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "2bnlB.bssp"
#ERROR : Can't open dsspfile "2bnlA.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "2c9oB.bssp"
#ERROR : Can't open dsspfile "3c94A.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "1delB.bssp"
#ERROR : Can't open dsspfile "2bwjF.bssp"
#ERROR : Can't open dsspfile "3cddB.bssp"
#ERROR : Can't open dsspfile "2bwjC.bssp"
#ERROR : Can't open dsspfile "3dzvA.bssp"
#ERROR : Can't open dsspfile "2dx7A.bssp"
#ERROR : Can't open dsspfile "3dsrB.bssp"
#ERROR : Can't open dsspfile "2bwjE.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "1eg7B.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"

## Summary of PDB Search
:1343
    5e-72  40%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    7e-66  45%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-48  26%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-46   7%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    2e-46  10%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    1e-45  18%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    3e-45   9%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    4e-45  10%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    7e-45  12%  2akaB  [x.x.x] DYNAMIN-1
    9e-45  11%  3cmvH  [x.x.x] PROTEIN RECA
    4e-44   8%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    7e-43  10%  2b8tA  [x.x.x] THYMIDINE KINASE
    8e-43   9%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    8e-41  10%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    8e-41  13%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-40  12%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-39  11%  3cmvC  [x.x.x] PROTEIN RECA
    1e-39  14%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-39  10%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    6e-39  10%  3cmvG  [x.x.x] PROTEIN RECA
    1e-38  11%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    2e-38  10%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    3e-38   8%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    5e-38  10%  4dcgA  [x.x.x] VP39
    8e-38   9%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    9e-38  16%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    1e-37  21%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-37  10%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    2e-37  11%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    2e-37   6%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    3e-37  10%  3cmvA  [x.x.x] PROTEIN RECA
    4e-37  11%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-36   8%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    4e-36  10%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    9e-36  10%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    1e-35   9%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    2e-35  14%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    4e-35  11%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-34   7%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    1e-34   7%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    3e-34  10%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    3e-34  14%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    4e-34  10%  1e98A  [c.37.1] THYMIDYLATE KINASE
    7e-34  12%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    2e-33   9%  2c9oC  [x.x.x] RUVB-LIKE 1
    3e-33  11%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    8e-33  14%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    9e-33   8%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    2e-32   8%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-32   9%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    5e-32   9%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    9e-32  12%  2c4rL  [x.x.x] RIBONUCLEASE E
    9e-32  11%  2cgtH  [x.x.x] 60 KDA GROEL
    1e-31  12%  2axzC  [x.x.x] PRGX
    2e-31  10%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    2e-31  15%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    3e-31  10%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-30  11%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-30  13%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    2e-30  12%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    2e-30  11%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    3e-30   8%  2bifA  [c.37.1 - c.60.1] PROTEIN
    8e-30  16%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    8e-30  11%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-29  12%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    1e-29  22%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    2e-29  11%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    2e-29  11%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    2e-29  11%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    2e-29   9%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    2e-29  13%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    3e-29  12%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    4e-29  10%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    6e-29  22%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-28   7%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-28  14%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-28  11%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-28   9%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    3e-28  11%  2cckA  [x.x.x] THYMIDYLATE KINASE
    4e-28   9%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    4e-28  11%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    5e-28  11%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    5e-28   8%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-28  14%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    7e-28  14%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-27  11%  1e0jA  [c.37.1] DNA HELICASE
    2e-27   9%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-27   9%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    2e-27  10%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-27   9%  3da4A  [x.x.x] COLICIN-M
    2e-27  10%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-27  13%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-27  12%  1aroP  [e.8.1] T7 RNA POLYMERASE
    4e-27  22%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-27  11%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    7e-27  10%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    9e-27  12%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    9e-27  14%  3bm2B  [x.x.x] PROTEIN YDJA
    1e-26  16%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    1e-26  11%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-26  12%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-26  13%  1e0jB  [c.37.1] DNA HELICASE
    3e-26  12%  3ec1A  [x.x.x] YQEH GTPASE
    3e-26   9%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    3e-26  14%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-26  10%  421pA  [x.x.x] H-RAS P21 PROTEIN
    4e-26  13%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    4e-26  12%  2b8tB  [x.x.x] THYMIDINE KINASE
    9e-26   9%  2ctsA  [x.x.x] CITRATE SYNTHASE
    1e-25   9%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    4e-25  10%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    5e-25  12%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    5e-25   8%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    6e-25   9%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    1e-24   9%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-24   8%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    1e-24  27%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    1e-24  13%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-24  23%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-24  10%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    2e-24   9%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    2e-24   9%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    3e-24  13%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    4e-24  13%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    5e-24  13%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    6e-24  27%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-24  19%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-23   7%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    1e-23  10%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    2e-23  10%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    3e-23  12%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    3e-23  10%  2b8tC  [x.x.x] THYMIDINE KINASE
    3e-23  11%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    4e-23  23%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-23   9%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    4e-23  15%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    8e-23  16%  3a00A  [x.x.x] GUANYLATE KINASE
    8e-23  13%  2bhvD  [x.x.x] COMB10
    9e-23  14%  1e6cA  [c.37.1] SHIKIMATE KINASE
    1e-22  22%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-22   9%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    3e-22  13%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    5e-22  12%  3adkA  [x.x.x] ADENYLATE KINASE
    7e-22  10%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    7e-22  10%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    8e-22   8%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    8e-22  14%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    8e-22   9%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    9e-22   9%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    9e-22  11%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    1e-21  11%  1e2hB  [c.37.1] THYMIDINE KINASE
    1e-21  11%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    1e-21   9%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    1e-21  12%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    2e-21  14%  2bdtA  [x.x.x] BH3686
    2e-21   9%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-21  15%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    2e-21  22%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    2e-21  10%  3cmvE  [x.x.x] PROTEIN RECA
    2e-21  13%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-21  10%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    3e-21  12%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    3e-21   9%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-21  10%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    4e-21  21%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-21  12%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    5e-21   9%  2c0bL  [x.x.x] RIBONUCLEASE E
    6e-21  14%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    6e-21  11%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    1e-20  17%  3c8uA  [x.x.x] FRUCTOKINASE
    1e-20   7%  2bx2L  [x.x.x] RIBONUCLEASE E
    1e-20   9%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    1e-20   9%  3bczC  [x.x.x] PROTEIN MEMO1
    1e-20  26%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-20  22%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-20  12%  3cmxA  [x.x.x] PROTEIN RECA
    2e-20  10%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    3e-20  13%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    3e-20  12%  2a1fF  [x.x.x] URIDYLATE KINASE
    4e-20  15%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    4e-20  10%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    4e-20  11%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    4e-20  11%  3cmvB  [x.x.x] PROTEIN RECA
    4e-20  11%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    6e-20  10%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    7e-20  10%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    7e-20  20%  2d2eA  [x.x.x] SUFC PROTEIN
    9e-20  14%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    9e-20  12%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    1e-19  14%  1e2kA  [c.37.1] THYMIDINE KINASE
    1e-19  13%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    2e-19  12%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    2e-19  12%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    2e-19  12%  2bhvA  [x.x.x] COMB10
    2e-19  12%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    3e-19  11%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    4e-19   8%  2cckB  [x.x.x] THYMIDYLATE KINASE
    5e-19  16%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    7e-19  16%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    7e-19  13%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    8e-19  12%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-19  16%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    1e-18  11%  1e2iA  [c.37.1] THYMIDINE KINASE
    1e-18  11%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    1e-18  10%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    2e-18  12%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-18  13%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-18  12%  3dlbB  [x.x.x] ARGONAUTE
    2e-18   7%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    2e-18  13%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-18  13%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    3e-18  23%  2d2fA  [x.x.x] SUFC PROTEIN
    3e-18  16%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-18  10%  3be4A  [x.x.x] ADENYLATE KINASE
    4e-18  26%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    4e-18   8%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-18  12%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-18  13%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    5e-18  14%  3cmtD  [x.x.x] PROTEIN RECA
    5e-18  11%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-18  12%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    6e-18   9%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    9e-18  15%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    1e-17   6%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    1e-17  15%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-17  14%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-17  13%  2dftC  [x.x.x] SHIKIMATE KINASE
    2e-17  13%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-17  14%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    2e-17  10%  2a1fD  [x.x.x] URIDYLATE KINASE
    2e-17  14%  2dftA  [x.x.x] SHIKIMATE KINASE
    2e-17  12%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-17  17%  3a00B  [x.x.x] GUANYLATE KINASE
    3e-17  14%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-17  11%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    3e-17  12%  1adoA  [c.1.10] ALDOLASE
    3e-17  14%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-17  11%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    4e-17  11%  3dfdA  [x.x.x] PROTEIN YQBN
    6e-17  13%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-17  15%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-17  12%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    8e-17  11%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    9e-17  11%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-16  10%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    1e-16   8%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    2e-16   9%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-16  14%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-16   7%  3cd9A  [x.x.x] GREEN FLUORESCENT PROTEIN
    2e-16   8%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-16  11%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    3e-16  12%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-16  13%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-16  11%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-16  12%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-16  14%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    4e-16  12%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-16  12%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    5e-16  13%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-16  12%  1e2lA  [c.37.1] THYMIDINE KINASE
    7e-16  10%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    8e-16  15%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    8e-16  10%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-16  19%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    9e-16   5%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    1e-15  12%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    1e-15   9%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    1e-15  14%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-15   7%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    1e-15   8%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    2e-15   9%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-15  16%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    3e-15   8%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    3e-15  14%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    3e-15  13%  1e2iB  [c.37.1] THYMIDINE KINASE
    4e-15  11%  1eamA  [c.66.1] PROTEIN (VP39)
    7e-15  14%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    7e-15  10%  2a1fE  [x.x.x] URIDYLATE KINASE
    8e-15  19%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-15  10%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-14   9%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    1e-14  22%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-14  11%  2b8tD  [x.x.x] THYMIDINE KINASE
    2e-14  14%  3e0cA  [x.x.x] DNA DAMAGE-BINDING PROTEIN 1
    2e-14  10%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    3e-14  11%  1e2mB  [c.37.1] THYMIDINE KINASE
    3e-14  12%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-14  15%  2ancF  [x.x.x] GUANYLATE KINASE
    3e-14   9%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    4e-14  16%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-14   5%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    6e-14  13%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    7e-14  15%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    7e-14  12%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    9e-14  11%  1e2jA  [c.37.1] THYMIDINE KINASE
    9e-14  12%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    1e-13  12%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-13   9%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    2e-13  11%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    2e-13  11%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    3e-13  13%  3cm0A  [x.x.x] ADENYLATE KINASE
    3e-13  24%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-13  13%  3cmwC  [x.x.x] PROTEIN RECA
    6e-13  13%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    7e-13   8%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    8e-13   9%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    1e-12  11%  2a1fC  [x.x.x] URIDYLATE KINASE
    1e-12  11%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    3e-12  14%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    7e-12  14%  1delA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    8e-12  15%  2an9A  [x.x.x] GUANYLATE KINASE
    1e-11  15%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    1e-11  15%  2anbA  [x.x.x] GUANYLATE KINASE
    1e-11  14%  2ancD  [x.x.x] GUANYLATE KINASE
    2e-11  11%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    2e-11  12%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-11  15%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    3e-11  10%  1e2nB  [c.37.1] THYMIDINE KINASE
    4e-11  14%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    4e-11  12%  2ancB  [x.x.x] GUANYLATE KINASE
    4e-11  20%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    6e-11  11%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    1e-10   7%  2c9gA  [x.x.x] PENTON PROTEIN
    1e-10  15%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    1e-10  12%  1e2hA  [c.37.1] THYMIDINE KINASE
    1e-10  15%  2b0lB  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    1e-10  16%  2c9oA  [x.x.x] RUVB-LIKE 1
    2e-10   5%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    2e-10  17%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-10  12%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    5e-10  11%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    8e-10   8%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    8e-10   9%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    1e-09  16%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-09   8%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    2e-09  16%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-09  12%  2bhvC  [x.x.x] COMB10
    2e-09  15%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    3e-09  24%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-09   9%  1e2nA  [c.37.1] THYMIDINE KINASE
    5e-09  16%  2c5mD  [x.x.x] CTP SYNTHASE
    5e-09  15%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    5e-09   6%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-09  12%  1e2kB  [c.37.1] THYMIDINE KINASE
    8e-09   7%  2bnlB  [x.x.x] MODULATOR PROTEIN RSBR
    1e-08   7%  2bnlA  [x.x.x] MODULATOR PROTEIN RSBR
    1e-08  16%  1e2lB  [c.37.1] THYMIDINE KINASE
    1e-08  16%  2c9oB  [x.x.x] RUVB-LIKE 1
    2e-08  16%  3c94A  [x.x.x] EXODEOXYRIBONUCLEASE I
    2e-08  13%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    3e-08  15%  3cmuA  [x.x.x] PROTEIN RECA
    4e-08  13%  2cdnA  [x.x.x] ADENYLATE KINASE
    4e-08  15%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    5e-08  11%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    8e-08  10%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-07   7%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    1e-07  14%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    2e-07   9%  2bnlC  [x.x.x] MODULATOR PROTEIN RSBR
    2e-07  13%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    3e-07  20%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    3e-07  18%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    4e-07  10%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    5e-07  14%  3cb9A  [x.x.x] GREEN FLUORESCENT PROTEIN
    5e-07  10%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    8e-07  17%  2c95B  [x.x.x] ADENYLATE KINASE 1
    8e-07  17%  1chdA  [x.x.x] CHEB METHYLESTERASE
    1e-06  15%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    1e-06  11%  3cddA  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-06  25%  1e2jB  [c.37.1] THYMIDINE KINASE
    2e-06  10%  1agpA  [x.x.x] C-H-RAS P21 PROTEIN
    3e-06  11%  1e2mA  [c.37.1] THYMIDINE KINASE
    3e-06  14%  3dkvA  [x.x.x] ADENYLATE KINASE
    4e-06   8%  1e6vC  [d.58.31] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    7e-06  15%  2a5fA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    8e-06  15%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    2e-05  18%  1delB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    2e-05  29%  2bwjF  [x.x.x] ADENYLATE KINASE 5
    2e-05   8%  3cddB  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-05  29%  2bwjC  [x.x.x] ADENYLATE KINASE 5
    3e-05  13%  3dzvA  [x.x.x] 4-METHYL-5-(BETA-HYDROXYETHYL)THIAZOLE KINASE
    3e-05   4%  2dx7A  [x.x.x] ASPARTATE RACEMASE
    3e-05  14%  3dsrB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    5e-05  16%  2dwuB  [x.x.x] GLUTAMATE RACEMASE
    7e-05  18%  1dapA  [c.2.1 - d.81.1] DIAMINOPIMELIC ACID DEHYDROGENASE
    1e-04  12%  3cddE  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-04  19%  2dfsA  [x.x.x] MYOSIN-5A
    1e-04  24%  2bwjE  [x.x.x] ADENYLATE KINASE 5
    1e-04  11%  3ci2A  [x.x.x] CHYMOTRYPSIN INHIBITOR 2
    1e-04  16%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-04   7%  2ch0A  [x.x.x] INNER NUCLEAR MEMBRANE PROTEIN MAN1
    3e-04  19%  1eg7B  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    3e-04  18%  3a25A  [x.x.x] UNCHARACTERIZED PROTEIN PH0793
    5e-04  11%  3cr8B  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    5e-04  15%  3cmwA  [x.x.x] PROTEIN RECA
    5e-04  14%  2afiM  [x.x.x] NITROGENASE IRON PROTEIN 1
    5e-04  20%  2ak3A  [c.37.1 - g.41.2] ADENYLATE KINASE ISOENZYME-3
    7e-04  15%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    7e-04  14%  1dwmA  [d.40.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    7e-04  17%  1akyA  [x.x.x] ADENYLATE KINASE
    4e-54  44%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN(query 1056->1340)
    4e-09  28%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN(query 835->889)
    7e-65  49%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING(query 426->674)
    5e-47  21%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 428->672)
    3e-43   8%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-(query 428->674)
    2e-42  10%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B(query 336->765)
    5e-41  17%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN(query 1115->1323)
    1e-43   9%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-(query 445->675)
    1e-44  10%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR(query 400->676)
    2e-43  11%  2akaB  [x.x.x] DYNAMIN-1(query 1101->1337)
    1e-42  11%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN(query 337->762)
    2e-37  10%  2b8tA  [x.x.x] THYMIDINE KINASE(query 1126->1325)
    7e-40  10%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN(query 388->676)
    5e-38  11%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN(query 337->741)
    1e-38  14%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 418->663)
    3e-40  14%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN(query 1063->1331)
    1e-37  16%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN(query 1063->1340)
    4e-38  10%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I(query 408->629)
    7e-36  12%  2ccgA  [x.x.x] THYMIDYLATE KINASE(query 1129->1337)
    4e-36   8%  1e9cA  [c.37.1] THYMIDYLATE KINASE(query 1124->1337)
    3e-34   9%  2ccjB  [x.x.x] THYMIDYLATE KINASE(query 1129->1332)
    7e-35  12%  4dcgA  [x.x.x] VP39(query 1095->1333)
    7e-34   9%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN(query 334->763)
    6e-37  15%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM(query 456->650)
    3e-34  20%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 425->687)
    3e-36  10%  2ccgB  [x.x.x] THYMIDYLATE KINASE(query 1126->1332)
    8e-37  11%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN(query 993->1338)
    2e-32  10%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN(query 338->765)
    1e-36  10%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR(query 1068->1340)
    3e-33   8%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC(query 290->712)
    1e-33  10%  1e9fA  [c.37.1] THYMIDYLATE KINASE(query 456->662)
    2e-34  13%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF(query 433->657)
    3e-35  13%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN(query 389->678)
    1e-31  10%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1(query 428->704)
    2e-34   9%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/(query 456->667)
    9e-31   7%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B(query 336->677)
    1e-28  11%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL(query 1126->1338)
    1e-33  14%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284(query 442->683)
    2e-33   8%  1e98A  [c.37.1] THYMIDYLATE KINASE(query 1124->1334)
    7e-32  10%  1e2dA  [c.37.1] THYMIDYLATE KINASE(query 1124->1334)
    3e-32  10%  2c9oC  [x.x.x] RUVB-LIKE 1(query 1076->1339)
    7e-32  12%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN(query 389->678)
    4e-32   9%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3(query 1113->1300)
    2e-31   7%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC(query 896->1337)
    6e-29   9%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC(query 270->674)
    2e-31  11%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6(query 1126->1281)
    1e-29   8%  2c4rL  [x.x.x] RIBONUCLEASE E(query 430->663)
    4e-28  11%  2cgtH  [x.x.x] 60 KDA GROEL(query 1099->1338)
    9e-31   8%  2axzC  [x.x.x] PRGX(query 1208->1326)
    4e-28  12%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF(query 431->659)
    1e-29  12%  2bofX  [x.x.x] ENDOGLUCANASE E-2(query 1149->1341)
    8e-25  11%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN(query 1129->1326)
    8e-30   8%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC(query 983->1333)
    4e-30  14%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1(query 411->672)
    8e-27  12%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED(query 428->680)
    2e-29   9%  1e9dA  [c.37.1] THYMIDYLATE KINASE(query 1124->1333)
    2e-29   6%  2bifA  [c.37.1 - c.60.1] PROTEIN(query 1129->1337)
    6e-27  11%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 426->705)
    2e-27  12%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 424->657)
    3e-26   8%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE(query 1126->1326)
    9e-26  20%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING(query 424->704)
    7e-27  14%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN(query 440->620)
    1e-27  10%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE(query 422->664)
    5e-29  10%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284(query 445->665)
    4e-27   9%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989(query 413->669)
    2e-28  11%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B(query 458->623)
    1e-27  12%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN(query 1030->1338)
    2e-27   8%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE(query 1129->1338)
    1e-27   7%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC(query 205->674)
    1e-25  13%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 424->676)
    1e-22  12%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN(query 1126->1337)
    2e-26  11%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE(query 1098->1338)
    3e-26  12%  2cckA  [x.x.x] THYMIDYLATE KINASE(query 1129->1332)
    5e-23   8%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE(query 418->667)
    1e-26  15%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)(query 1154->1333)
    6e-28  13%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280(query 1129->1272)
    9e-27  10%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 421->660)
    4e-26  10%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 424->681)
    2e-26  13%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 424->663)
    1e-22  10%  1e0jA  [c.37.1] DNA HELICASE(query 421->692)
    5e-26  12%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 421->644)
    3e-26   8%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE(query 433->668)
    2e-23   9%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1(query 425->677)
    4e-26  10%  3da4A  [x.x.x] COLICIN-M(query 377->594)
    3e-25  13%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 421->615)
    1e-24  11%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 424->643)
    2e-26   6%  1aroP  [e.8.1] T7 RNA POLYMERASE(query 1189->1337)
    1e-24  19%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 428->668)
    2e-21   9%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE(query 406->674)
    6e-25  11%  1e2fA  [c.37.1] THYMIDYLATE KINASE(query 456->678)
    1e-24  13%  3bm2B  [x.x.x] PROTEIN YDJA(query 511->667)
    8e-24  14%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR(query 1143->1323)
    5e-26  10%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1(query 428->664)
    3e-20  12%  1e0jB  [c.37.1] DNA HELICASE(query 419->678)
    1e-25   9%  3ec1A  [x.x.x] YQEH GTPASE(query 479->674)
    6e-24  13%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639(query 1153->1300)
    4e-23  15%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 1207->1337)
    2e-23  10%  421pA  [x.x.x] H-RAS P21 PROTEIN(query 460->618)
    3e-23  15%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE(query 1204->1341)
    4e-23  11%  2b8tB  [x.x.x] THYMIDINE KINASE(query 1126->1331)
    3e-24   9%  2ctsA  [x.x.x] CITRATE SYNTHASE(query 442->632)
    2e-25  11%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1(query 428->683)
    2e-24  10%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR(query 420->674)
    4e-22  13%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284(query 445->691)
    1e-20   9%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT(query 1101->1337)
    5e-22  10%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B(query 446->629)
    2e-24  12%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 421->659)
    2e-19   9%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN(query 419->677)
    7e-22  29%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN(query 428->665)
    3e-23  13%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 424->676)
    4e-23  21%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 433->681)
    1e-22   8%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE(query 1126->1339)
    1e-23  10%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3(query 1107->1315)
    3e-19   6%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE(query 385->679)
    4e-18  14%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN(query 380->524)
    2e-22  15%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1(query 1098->1326)
    2e-23  14%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE(query 455->628)
    7e-23  26%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 439->667)
    7e-22  15%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR(query 400->654)
    9e-23  11%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE(query 456->653)
    2e-23   7%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2(query 505->704)
    7e-23  10%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE(query 456->681)
    2e-22  12%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN(query 509->676)
    1e-20  14%  2b8tC  [x.x.x] THYMIDINE KINASE(query 1126->1324)
    2e-21  10%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE(query 1126->1328)
    2e-20  19%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 428->668)
    5e-19   9%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE(query 292->692)
    2e-22  14%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284(query 445->680)
    1e-20  18%  3a00A  [x.x.x] GUANYLATE KINASE(query 1127->1296)
    4e-19  14%  2bhvD  [x.x.x] COMB10(query 1161->1334)
    2e-22  10%  1e6cA  [c.37.1] SHIKIMATE KINASE(query 457->620)
    2e-21   7%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE(query 515->681)
    2e-16  12%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA(query 384->671)
    8e-20  12%  3adkA  [x.x.x] ADENYLATE KINASE(query 450->648)
    7e-22   8%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I(query 1131->1295)
    2e-20   9%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1(query 428->678)
    1e-19  11%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE(query 456->653)
    1e-19  16%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284(query 445->673)
    5e-21   6%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM(query 325->679)
    6e-21  10%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE(query 1116->1343)
    8e-19  13%  1e2hB  [c.37.1] THYMIDINE KINASE(query 1123->1339)
    1e-21   9%  3ecpA  [x.x.x] TN5 TRANSPOSASE(query 1173->1338)
    3e-20  10%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE(query 1112->1338)
    2e-16  11%  2c7cH  [x.x.x] 60 KDA CHAPERONIN(query 1222->1338)
    5e-21  13%  2bdtA  [x.x.x] BH3686(query 1129->1291)
    1e-20  12%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 428->660)
    7e-18  13%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX(query 1148->1291)
    2e-20  12%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 418->676)
    7e-20   8%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE(query 1126->1316)
    6e-20  13%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE(query 451->626)
    4e-20  11%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 421->659)
    9e-21  12%  1e2gA  [c.37.1] THYMIDYLATE KINASE(query 456->678)
    3e-17  18%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 428->679)
    7e-21  13%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE(query 419->664)
    3e-19   7%  2c0bL  [x.x.x] RIBONUCLEASE E(query 433->663)
    5e-20  11%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE(query 433->749)
    7e-20  11%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA(query 388->674)
    4e-20  17%  3c8uA  [x.x.x] FRUCTOKINASE(query 1105->1323)
    5e-19   7%  2bx2L  [x.x.x] RIBONUCLEASE E(query 1137->1329)
    3e-17   9%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN(query 420->647)
    4e-17   7%  3bczC  [x.x.x] PROTEIN MEMO1(query 1121->1337)
    3e-19  20%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 428->668)
    3e-20  13%  3cmxA  [x.x.x] PROTEIN RECA(query 453->666)
    5e-17  10%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN(query 412->685)
    1e-17  10%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE(query 1087->1332)
    1e-19  11%  2a1fF  [x.x.x] URIDYLATE KINASE(query 577->695)
    4e-20  16%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE(query 455->628)
    5e-18  11%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2(query 1126->1337)
    6e-16   9%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE(query 1148->1327)
    2e-16  15%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN(query 417->604)
    6e-20   9%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE(query 1119->1282)
    4e-18   7%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE(query 1111->1336)
    1e-17  22%  2d2eA  [x.x.x] SUFC PROTEIN(query 428->674)
    3e-19  12%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE(query 1205->1338)
    2e-18  10%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB(query 436->649)
    4e-19  17%  1e2kA  [c.37.1] THYMIDINE KINASE(query 1124->1337)
    9e-19  12%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE(query 422->670)
    1e-16  11%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE(query 1129->1270)
    3e-16  13%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284(query 439->694)
    2e-17  15%  2bhvA  [x.x.x] COMB10(query 1161->1333)
    2e-18  10%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))(query 419->661)
    6e-17   7%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE(query 1126->1316)
    2e-18   9%  2cckB  [x.x.x] THYMIDYLATE KINASE(query 1129->1306)
    6e-18  15%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN(query 1219->1343)
    7e-18  14%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN(query 1220->1343)
    5e-18  12%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN(query 1179->1325)
    3e-18  10%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 1092->1270)
    2e-16  18%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE(query 442->616)
    9e-18  12%  1e2iA  [c.37.1] THYMIDINE KINASE(query 1123->1337)
    2e-16  13%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN(query 1224->1331)
    5e-18  10%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)(query 1129->1288)
    2e-17  15%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE(query 1205->1324)
    2e-17  16%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 1189->1341)
    3e-16  11%  3dlbB  [x.x.x] ARGONAUTE(query 453->667)
    1e-16   8%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)(query 427->558)
    3e-16  17%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 1189->1338)
    6e-18  14%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE(query 1126->1292)
    2e-14  21%  2d2fA  [x.x.x] SUFC PROTEIN(query 428->674)
    5e-17  10%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)(query 1126->1222)
    4e-18  12%  3be4A  [x.x.x] ADENYLATE KINASE(query 1123->1316)
    3e-17  24%  1b0uA  [c.37.1] HISTIDINE PERMEASE(query 428->683)
    9e-16  11%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 421->663)
    1e-17  18%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 1189->1341)
    5e-16  16%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE(query 1189->1341)
    2e-17   8%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 1239->1326)
    4e-16  11%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE(query 1126->1340)
    2e-16   6%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)(query 1093->1301)
    1e-16  13%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE(query 422->656)
    3e-17   9%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE(query 572->659)
    3e-15  11%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)(query 1126->1198)
    1e-16  10%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 1239->1319)
    2e-14  12%  2dftC  [x.x.x] SHIKIMATE KINASE(query 457->616)
    2e-15   8%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 1239->1326)
    5e-16   7%  1aldA  [c.1.10 (2aldA)] ALDOLASE A(query 1239->1319)
    2e-16   7%  2a1fD  [x.x.x] URIDYLATE KINASE(query 583->667)
    5e-15  11%  2dftA  [x.x.x] SHIKIMATE KINASE(query 457->616)
    4e-13  15%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN(query 379->603)
    5e-16  20%  3a00B  [x.x.x] GUANYLATE KINASE(query 1129->1296)
    1e-16   8%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 1239->1326)
    7e-16  12%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE(query 443->633)
    6e-16  10%  1adoA  [c.1.10] ALDOLASE(query 1239->1328)
    2e-16   7%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 1239->1319)
    2e-16  12%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN(query 510->657)
    4e-14  11%  3dfdA  [x.x.x] PROTEIN YQBN(query 426->556)
    2e-15   8%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 1239->1326)
    3e-15   7%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 1098->1310)
    3e-14  10%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN(query 389->679)
    6e-14  16%  2bwjA  [x.x.x] ADENYLATE KINASE 5(query 448->652)
    3e-12  17%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 1189->1324)
    1e-15   8%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE(query 389->512)
    3e-16  11%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK(query 440->643)
    8e-16  12%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE(query 456->645)
    6e-16   8%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 1239->1326)
    6e-16   9%  3cd9A  [x.x.x] GREEN FLUORESCENT PROTEIN(query 1009->1194)
    1e-15  12%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 428->704)
    2e-15  11%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE(query 540->686)
    5e-13  16%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 1189->1341)
    1e-12  16%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 1189->1341)
    4e-16   8%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 1239->1326)
    2e-15   8%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 1098->1336)
    4e-15   7%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE(query 1237->1319)
    1e-15  10%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 1239->1319)
    1e-15  13%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN(query 1180->1325)
    2e-15  10%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 1098->1276)
    3e-13  10%  1e2lA  [c.37.1] THYMIDINE KINASE(query 1123->1336)
    9e-16   8%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE(query 1129->1323)
    1e-15  12%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC(query 591->667)
    6e-12  14%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 422->663)
    4e-15  24%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA(query 541->611)
    2e-14   9%  3czjA  [x.x.x] BETA-GALACTOSIDASE(query 1235->1314)
    3e-15  10%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE(query 1098->1301)
    8e-15   7%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE(query 1129->1325)
    4e-15   8%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 1239->1326)
    8e-14  11%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN(query 397->563)
    6e-15  11%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3(query 1115->1299)
    9e-15  12%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 422->704)
    4e-11  13%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE(query 1130->1323)
    1e-12   7%  3dymA  [x.x.x] BETA-GALACTOSIDASE(query 1227->1334)
    1e-11  12%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1(query 453->627)
    2e-13  18%  1e2iB  [c.37.1] THYMIDINE KINASE(query 1124->1306)
    6e-14   8%  1eamA  [c.66.1] PROTEIN (VP39)(query 411->663)
    2e-12  16%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)(query 1126->1229)
    3e-14   8%  2a1fE  [x.x.x] URIDYLATE KINASE(query 583->667)
    9e-09  21%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 1281->1338)
    3e-13  17%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 422->524)
    4e-13   9%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1(query 428->669)
    7e-13  20%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 428->663)
    3e-14  10%  2b8tD  [x.x.x] THYMIDINE KINASE(query 1126->1329)
    4e-13  11%  2ccjA  [x.x.x] THYMIDYLATE KINASE(query 1129->1332)
    1e-11  14%  1e2mB  [c.37.1] THYMIDINE KINASE(query 1124->1325)
    2e-13   9%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 1239->1329)
    3e-13  14%  2ancF  [x.x.x] GUANYLATE KINASE(query 1125->1271)
    6e-12  11%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330(query 1098->1198)
    5e-12  12%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 426->705)
    2e-12   7%  3dyoA  [x.x.x] BETA-GALACTOSIDASE(query 1208->1330)
    8e-14  12%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE(query 1093->1261)
    3e-13  15%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN(query 1071->1307)
    7e-12   9%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 1239->1316)
    5e-10  10%  1e2jA  [c.37.1] THYMIDINE KINASE(query 1124->1325)
    2e-06  12%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT(query 389->469)
    3e-06  20%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT(query 624->674)
    3e-12  10%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 1237->1328)
    2e-12  13%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE(query 1129->1319)
    1e-12  11%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)(query 1139->1331)
    2e-12  12%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE(query 1188->1329)
    2e-10  13%  3cm0A  [x.x.x] ADENYLATE KINASE(query 1126->1302)
    1e-10  13%  3cmwC  [x.x.x] PROTEIN RECA(query 453->529)
    3e-12  12%  2boeX  [x.x.x] ENDOGLUCANASE E-2(query 1199->1337)
    1e-10   8%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107(query 400->675)
    2e-11  12%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330(query 1098->1183)
    5e-12   9%  2a1fC  [x.x.x] URIDYLATE KINASE(query 577->667)
    4e-09  13%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6(query 456->623)
    6e-11  11%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT(query 1123->1194)
    9e-09  12%  1delA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE(query 1129->1272)
    2e-11  14%  2an9A  [x.x.x] GUANYLATE KINASE(query 456->664)
    4e-10  16%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)(query 1125->1316)
    4e-11  14%  2anbA  [x.x.x] GUANYLATE KINASE(query 456->664)
    1e-10  16%  2ancD  [x.x.x] GUANYLATE KINASE(query 1126->1327)
    2e-11  10%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE(query 1165->1261)
    5e-09  12%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE(query 1125->1313)
    1e-10  15%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE(query 413->494)
    5e-09  14%  1e2nB  [c.37.1] THYMIDINE KINASE(query 1124->1327)
    4e-07  38%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1(query 1286->1337)
    1e-06  38%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1(query 1097->1139)
    2e-10  15%  2ancB  [x.x.x] GUANYLATE KINASE(query 1125->1326)
    5e-10  19%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)(query 1126->1191)
    1e-10  12%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE(query 460->653)
    3e-07   9%  2c9gA  [x.x.x] PENTON PROTEIN(query 380->485)
    7e-10  16%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT(query 1126->1194)
    1e-08  13%  1e2hA  [c.37.1] THYMIDINE KINASE(query 1124->1340)
    3e-10  13%  2b0lB  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC(query 592->674)
    1e-08  13%  2c9oA  [x.x.x] RUVB-LIKE 1(query 403->659)
    2e-10   8%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE(query 1220->1330)
    3e-09  17%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT(query 1126->1167)
    2e-09  16%  1azsC  [c.37.1 - a.66.1] GS-ALPHA(query 453->524)
    3e-09  10%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN(query 1244->1343)
    1e-09   7%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4(query 460->635)
    2e-08   8%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I(query 1173->1286)
    5e-08  13%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)(query 1126->1191)
    1e-08  10%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL(query 1256->1323)
    2e-09  12%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 1092->1173)
    3e-09  15%  2bhvC  [x.x.x] COMB10(query 491->661)
    1e-08  15%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT(query 1129->1181)
    1e-06  20%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 426->469)
    1e-06  27%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 1293->1333)
    1e-07  16%  1e2nA  [c.37.1] THYMIDINE KINASE(query 1124->1264)
    8e-09  18%  2c5mD  [x.x.x] CTP SYNTHASE(query 1227->1324)
    4e-08  18%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-(query 456->588)
    2e-07  15%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 422->501)
    2e-08  13%  1e2kB  [c.37.1] THYMIDINE KINASE(query 454->590)
    2e-06   5%  2bnlB  [x.x.x] MODULATOR PROTEIN RSBR(query 967->1064)
    2e-05   8%  2bnlA  [x.x.x] MODULATOR PROTEIN RSBR(query 967->1050)
    1e-05  10%  1e2lB  [c.37.1] THYMIDINE KINASE(query 454->665)
    3e-07  14%  2c9oB  [x.x.x] RUVB-LIKE 1(query 403->481)
    2e-05  14%  3c94A  [x.x.x] EXODEOXYRIBONUCLEASE I(query 593->674)
    3e-07  13%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2(query 460->625)
    6e-08  11%  2cdnA  [x.x.x] ADENYLATE KINASE(query 1124->1270)
    3e-07  20%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-(query 435->589)
    2e-04   9%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR(query 624->667)
    4e-04  17%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR(query 400->505)
    5e-05  15%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR(query 400->469)
    5e-05   4%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR(query 630->676)
    7e-04   5%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321(query 1119->1314)
    3e-06  15%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A(query 460->626)
    4e-07  29%  2bwjD  [x.x.x] ADENYLATE KINASE 5(query 446->487)
    2e-05  26%  2bwjB  [x.x.x] ADENYLATE KINASE 5(query 450->487)
    1e-04  12%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN(query 433->634)
    9e-05  13%  2c95B  [x.x.x] ADENYLATE KINASE 1(query 450->611)
    3e-06  16%  1chdA  [x.x.x] CHEB METHYLESTERASE(query 1253->1325)
    4e-06  10%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)(query 430->546)
    7e-06  13%  1e2jB  [c.37.1] THYMIDINE KINASE(query 453->546)
    2e-05  15%  1e2mA  [c.37.1] THYMIDINE KINASE(query 1124->1332)
    4e-06  11%  3dkvA  [x.x.x] ADENYLATE KINASE(query 1129->1210)
    1e-05   5%  1e6vC  [d.58.31] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT(query 1234->1272)
    2e-04  10%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)(query 431->546)
    6e-04  14%  1delB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE(query 457->524)
    2e-05  21%  2bwjF  [x.x.x] ADENYLATE KINASE 5(query 1123->1155)
    2e-04   7%  3cddB  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN(query 1102->1167)
    2e-05  21%  2bwjC  [x.x.x] ADENYLATE KINASE 5(query 1123->1155)
    1e-04  12%  3dzvA  [x.x.x] 4-METHYL-5-(BETA-HYDROXYETHYL)THIAZOLE KINASE(query 586->693)
    0.001   5%  2dx7A  [x.x.x] ASPARTATE RACEMASE(query 1244->1326)
    7e-05   9%  3dsrB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN(query 433->523)
    5e-04  29%  2bwjE  [x.x.x] ADENYLATE KINASE 5(query 453->487)
    4e-04  15%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 1098->1146)
    8e-04  14%  1eg7B  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE(query 1110->1230)
    9e-04  14%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC(query 453->713)
:1343

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3b60A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3e0cA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
3cb9A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dzvA           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2dwuB           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
2dfsA           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2ch0A           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
3a25A           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
2afiM           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1akyA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dzvA           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3b60A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3e0cA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
3cb9A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dzvA           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2dwuB           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
2dfsA           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2ch0A           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
3a25A           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
2afiM           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1akyA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dzvA           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxYTCTVGFIYTGEHIAQKIRERYLDAVLRQNIAFFDKLGAGEITTR
3b60A           -------------------------YISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSR
3b5jA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3e0cA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
3cb9A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dzvA           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2dwuB           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
2dfsA           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2ch0A           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
3a25A           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
2afiM           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1akyA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------GSMPPQ
3bb1E           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dzvA           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ITADTNLIQDGISEKVGXXXXXXXXXXXXXXIGFIKYWKLTLICCSTVVAIVTIMGGASRFIIRFSKKNV
3b60A           ITYDSEQVASXXXXXXXXXXXXXXXXXXXXXXXFYYSXXXXXXXXXXXXXXXXXXXXXXKRFRSISKNMQ
3b5jA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1accA           -------------------------------------------------------------------MEN
3b2qB           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3dt2A           -------VRKFVEGNAQLCQPEYIHICDGSEEEYGRLLAHMQEEGVIRKLKKYDNCWLALTDPRDVARIE
3dt4A           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3e0cA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bnlB           ---------------------------------------------------------SNQ---TVYQFIA
2bnlA           ---------------------------------------------------------SNQ---TVYQFIA
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bnlC           ---------------------------------------------------------------TVYQFIA
1dw9A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
3cb9A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dzvA           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2dwuB           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
2dfsA           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2ch0A           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
3a25A           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
2afiM           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1akyA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
3dt4A           -----------------------------------------------------------LTDPRDVARIE
2a5gA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3dt7A           LHNGLDFSAKFVEGNAQLCQPEYIHICDGSEEEYGRLLAHMQEEGVIRKLKKYDNCWLALTDPRDVARIE
3bb1E           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dzvA           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ESYGEGGTVAEEVLSSIRNATAFGTQEKLAKQYDAHLLEAQKWGTKLQMTIGIMVGGMMSIVFLNYGLGF
3b60A           NTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQGMKMVSASSISXXXXXXXXXXXXXXXX
3b5jA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1accA           IILSKNETISKNTSTSRTHTSEVVSAGFSNSNSSTVAIDHSLGGLNTADTARLNANIRYVNTGTAPIYNV
3b2qB           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3dt2A           SKTVIITQEQRDTVPIPKSGQSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIGSPLAKIGIELTDSPYV
3dt4A           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3dt4C           ---------QRDTVPIPKSGQSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGKIGIELTDSPYV
3d7wA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3cd9A           --------------------------------------------ILVELD-GDVNGHKFSVSGEGEGD-A
1e9rG           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3e0cA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bnlB           ENQNELLQLWTDTLKELSEQESYQLTDQVYENISKEYIDILLLSVKDENAAESQ-ISELALRAVQIGLSK
2bnlA           ENQNELLQLWTDTLKELSEQESYQLTDQVYENISKEYIDILLLSVKDE-NAAESQISELALRAVQIGLSK
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bnlC           ENQNELLQLWTDTLKELSEQESYQLTDQVYENISKEYIDILLLSVKDENAALRAVQIGLSKFLATALAEF
1dw9A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
3cb9A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dzvA           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2dwuB           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
2dfsA           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2ch0A           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
3a25A           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
2afiM           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1akyA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c61B           -------------------------------------------------------GPLIFVEKTEPVGYN
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
3eiuA           --------------------------------------------------------GPLIFVEKTEPVGY
2b8tA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           --------------------------------------------------------GPLIFVEKTEPVGY
3bb1A           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3b2qA           -----------------------------------------------------IAGPLIFVEKTE-PVGY
2cjwB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
3b2qB           ---------------------------------------------------------VEKTEPVGYNEIV
3dmdB           ----------------------------------------------------------------------
3dtbB           ---------QRDTVPIPKSGQSQLGRWMSEEDFEKAFNARFPGCMKGRTMGPLGSPLAKIGIELTDSPYV
1e9fA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2c61A           -------------------------------------------------------GPLIFVEKTEPVGYN
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
3dt4A           SKTVIITQEQRDTVPIPKSGQSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPIGIELTDSPYV
2a5gA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3dt7A           SKTVIITQEQRDTVPIPKSGQSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLSPYVVA
3bb1E           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bgwA           -----------ELIKECPLTPEHFSPGKHFNIYFTMQDLDRKGQSVDFTSIAARVGEKLPQLGGFGYLTE
2dr3C           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2ck3C           --------------------------------------------LEETGRVLSIGDGIARVHGLRAEEMV
1e59A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dzvA           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           WMGSRFIVSGXXXXXXXXXXXXXXXXGSFSLGNVTPNAQAFTSAIAAGAKIFSTIDRKSPIDPTSEDGET
3b60A           XXXXXXXVMDXXXXXXXXXXXXXXXXXXXXXXXLTNVNAQFQRGMAACQTLFAILDSEQEKDE---GKRV
3b5jA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dm5A           --------------------------------------RALIQADVNVRLVLQLTREIQRRA---LEEKP
3cmvC           ----------------------------------------------------------GQIEKQFGKGSI
2c03B           --------------------------------------RALMDADVNLEVTRDFVERVREEALGKQVLES
3c95A           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
4dcgA           --------------------------------------------VVSLDKPFMYFEEIDN----------
3b2qA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1accA           LPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIALDFSSTPITMNYNQFLELEKTKQLRLD
3b2qB           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3dmdB           -------------------------------------------------ALREKIKQKLVGKKV-RIGTD
3dtbB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2c9oC           -------------------------------------------------KSTTKTQRIASHSHVKGLGLD
3czpB           ----------------------------------------------------------------AEVGHS
2c04A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3dt2A           VASMRIMTRMGTSVLEALGDGEFIKCLHSVGCPLPLKKPLVNNWNPELTLIAHLPDRREIISFGSGYGGN
3dt4A           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2cgtH           -------------------------------------AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKG
2axzC           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3dt4C           VASM-RIMTRMGTSVLEALGDGEFIKCLHSVGCPLPLKKPLVNCNPELTLIAHLPDRREIISFGSGYGGN
3d7wA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cddF           ---------------------------TRSLEASGAFDLETYKFNDAQYKAFIEPIKQGQACTVDIGGE-
1e4yA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
3czpA           -----------------------------------------------------------------ESAEV
2b92B           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2bjbA           --------------------------------------------------------------LRSRDTEL
2a1fF           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3cd9A           TYGKLTTTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFE
1e9rG           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3e0cA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2d7vB           ------------------------------------NQYSRAHTWEFDGGSKILASAS-PHVVPVPLSVE
2awoD           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dpyA           -----------------------------------------------------------PLDPAPDTLET
2bv7A           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2d7vA           ------------------------------------NQYSRAHTWEFDGGSKILASAS-PHVVPVPLSVE
2a1fC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bnlB           FLATALAEFW------------------------------------------------------------
2bnlA           FLATALAEFW------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
3cmuA           ---------------------------------------------------------------QFGKGSI
2cdnA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bnlC           WKRLYTKNDK------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
3cb9A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dzvA           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2dwuB           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
2dfsA           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2ch0A           ----------------------------------------------------------------------
1eg7B           ------------------------------------------------------IAQAAKMKPVMELARG
3a25A           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
2afiM           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1akyA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c61B           EIVNIKMGDGTVRRGQVLDSSADIVVVQVF--IFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQL
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3dmdC           -------------------------------------------------ALREKIKQK-LVGKKVRIGTD
2akaB           ----------------------------------------------------------------------
3eiuA           NEIVNIKMGDGTVRRGQVLDSSADIVVV--QVFFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQL
2b8tA           ----------------------------------------------------------------------
1dkiA           -------------------------------------GYSTSGSFDVNGKENIASFMESYVEQI-KENKK
3eiuB           NEIVNIKMDGTVRRGQVLDSSADIVVVQVFIF--TGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQL
3bb1A           -------------------------------------------------------------------ASQ
3dm5A           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3c95A           ---------------------------------------------------------HVSGMFGAWRGNT
2ccgA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3b2qA           NEIVNIKMGDGTVRRGQVLDSSADIVVVQVFEIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQL
2cjwB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
3b2qB           NIKMGDGTVRRGQVLDSSADIVVVQVFEGVIF--TGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQL
3dmdB           ----------------------------------------------------------------------
3dtbB           VASMRIMTRMGTSVLEALGDGEFIKCL-HSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGY
1e9fA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c03A           --------------------------------------RALMDADVNLEVTRDFVERVREEALGKQVLES
2b8wA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2c61A           EIVNIKMGDGTVRRGQVLDSSADIVVV---QVFFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQL
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2c04A           --------------------------------------RALMDADVNLEVARDFVERVREEALGKQVLES
2czvA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
3dt4A           VASMRIMTRMGTSVLEALGDGEFIKCLHSCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGN
2a5gA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3d7wA           ------------------------------------------------------------LRLRTDQQTT
1dg3A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3di4A           --------------------------------------------------------------ICYPNDSL
3a1wA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3dt7A           SMRIMTRMGTSVLEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGN
3bb1E           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2eg5G           -------------------------------------------------------------------GDT
3bjdB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3da4A           --------------------------GPLLVQVVYSFFQSPNMCLQALTQLEDYIKKHGASNPLTLQGYF
1e9sF           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bh0A           -------------------------------------------------------SIDEALVTVYEEIE-
1e2fA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e0jB           --------------------------------------------------------------------SL
3ec1A           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e3mA           ---------------------------------------------------------------------I
2dr3B           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2bkhA           --------------------------------------------------------------------ET
3dhwC           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------TGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKAR
3ed8A           -----------------------------RYPDHMKQHDFFKSAMPEGYVQERTISDDGKYKTRAVVKFE
2d4hB           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3dm9B           -------------------------------------------------ALREKIKQK-LVGKKVRIGTD
2a30D           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bgwA           LAASVASTTTFKQHCQTVSEYFQKRKAISIAQQIIENVNVKPIQEAVSELMEIEASGTDDDDGSIDEALV
2dr3C           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2dflA           ---------------------------------LETLAVASPQDLSVAAGIPLSTAQKIIKEARDALDIR
3adkA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2ck3C           EFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDITGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKAR
1e59A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3bb1G           -------------------------------------------------------------------ASQ
2a30A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1cr1A           --------------------------------------------------------------------ER
2c0bL           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2bkeA           -------------------------------------ETLAVASPQDLSVAAGIPLSTAQKIIKEARDAL
3c8uA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bo6B           ---------------------------------------------------------------------T
3bczC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2bkiA           -------------------------------------------------------------IPKIYSSET
2bjbA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cnlA           ------------------------------------------------------------------DEKT
3ch4B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1av6A           --------------------------------------------------------------------EI
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3cnnA           ----------------------------VEVRDARAPFATSAYGVDFSRKETIILLNKVDIADEKTT---
3a00B           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dm5B           --------------------------------------RALIQADVNVRLVLQLTREIQRRA---LEEKP
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1d2zD           --------------------------------------YRLAKILDENSCWRKLMSIIPKGMD--VQACS
3cioD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------VETTLCPNANSRVSKNNFDSRYPT
2czvB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1eamA           ------------------------------------------------------------VVSLDKPFMY
1cjtC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3b9qA           --------------------------------------EALLVSDFGPKITVRIVERL----REDIMSGK
3b9qA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cqcA           -------------------------------------------------LKIDVIDWLVFDPAQRAEAL-
2d7vA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3do6A           --------------------------------------------------------------PIKEIADQ
1e2nB           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2c9gA           -----------------------------PGEASTQTINLDDRSHWGGDLKTILHTNMPNVNEFMFTNKF
3c14C           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------TKTQRIASHSHVKGLGLD
1dp0A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------TKTQRIASHSHVKGLGLD
3c94A           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3e70C           -------------------------------------------------ALREKIKQK-LVGKKVRIGGK
3dmdA           -------------------------------------------------ALREKIKQK-LVGKKVRIGTD
3dmdA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dzvA           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LEKVEGNIEFRDIRHIYPSRPEVLVMKGVNLFVPAGKTTALVGPSGSGKSTVIGLLERFYNPVGGSVLVD
3b60A           IDRATGDLEFRNVTFTYPGR-EVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMD
3b5jA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ------KLYLKGFKSF----------GRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAG
2dwpA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------EDLIPLVNRLQDAF--SAIGQNALDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVT
3cmvH           ----RLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFI
3eiuA           ----------------------------------------------------------------------
2b8tA           -----------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVF
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dm5A           PAGISKKEHIIKIVYEELTKFLGTE-AKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVV
3cmvC           MR--LGEDRSMDVETISTGSL-SLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFI
2c03B           LTP--AEVILATVYEALKEAL---GGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLV
3c95A           ----------------------------------------------------------------------
3cmvG           ----LGEDRSMDVETISTGS-LSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFI
2ccgA           ------------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTR
1e9cA           -----------------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELL
2ccjB           ------------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTR
4dcgA           -ELDYEPESANEVAKKLPYQGQLKLLLGELFFLSGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWM
3b2qA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           -----------------------------------SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTR
1accA           TDQVYGNIATYNFENGRVRVDTARIIFNGKDLNLVERRIAAVNPSTTKPDMALKIAFGFNEPNG-NLQYQ
3b2qB           ----------------------------------------------------------------------
3cmvA           ----------ETISTGSLSLDIALG----AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFI
3dmdB           KGKIIEEAVKEAVSEILE-TSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIA
3dtbB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2c9yA           -----------------------------------GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDM
2dr3A           ----------------------------------------------------------------------
1e98A           -----------------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELL
1e2dA           -----------------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELL
2c9oC           ESGLA-KQAASGLVGQENAREACGIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMV
3czpB           IDKDTYEKAVIELREAL-----LEAQFELKQQARFPVIILINGIEGAGKGETVKLLNEWDPRLIEVQSFL
2c04A           ----------------------------------------------------------------------
2czvA           ------------------------GVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKE
3dt2A           LGKKCFALRIASRLAKEEGWLAHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDD
3dt4A           ----------------------------------------------------------------------
2a5gA           -----------------------------------EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGF
2c4rL           ----------------------------------------------------------------------
2cgtH           RNV----VLDKSFGAPTITKDGVSVAREIELEDFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITE
2axzC           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------YVNPNMSSAEWV
3cddC           -------------------------------------VLKAGGKIYQGWTKTRSLEASGTYKFQYKAFIE
3dt4C           LGKKCFALRIASRLAKEEGLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDD
3d7wA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9dA           -----------------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELL
2bifA           -----------------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREF
2awnD           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a2zD           -----------------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPV
2d62A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cddF           ---RVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVN
1e4yA           ---------------------------------------ILLGALVAGKGTQAQFIMEKYGIPQISTGDM
2awnB           -----------------------------------GNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAI
3dt7A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3cddD           --------------------------------------TRSLEASGAFDLETYKF----NDAQYKAFIEP
3bpbA           ------HIIARTPARSLVDGLTSSHLGKPDYAKALEQHNAYIRALQVDITLDERFPDSVFVEDPVLCTSR
2cckA           ------------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTR
2eg5G           ----------------------------------------------------------------------
3bjdB           --------------------------------------------------SLPQLQ----NLPIEEARIV
2axpA           --------------------------------------IILEGPDCCFKSTVAAKLSKELKYPIIKGSSF
1e9sG           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------VNLAERAYTLNYTCPTFI
3czpA           GHSIDKDTYEKAVIELREALLEAQ--FELKQQARFPVIILINGIEGAGKGETVKLLNEWDPRLIEVQSFL
2b92B           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3cbnA           --------------------------------------------------------------LRYTLRAR
1dhjA           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2b8tB           -----------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVF
2ctsA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e3aB           -------------------WTQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWD
2a5jA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2a2zA           -----------------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPV
3d3kA           -------------PSISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTVACGPHVKG
1bmfC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2d4hB           -------CLIENTNGRLMANPEALILSAITQPMVVV---AIVGLYRTGKSYLMIWMWCVPHPKKPGHILV
3cr7C           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2b8tC           -----------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVF
3d3qA           -----------------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQ
2d3wD           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3a00A           ------------------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSS
2bhvD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2awoC           -------------------------------------------QIPSIRQNLVYRQNDVVLVEEGATFAI
2ausC           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------PLGSGGLFFNALKNCKENFTVLQTIRQQQS
2b8wB           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
1e59A           -----------------------------KLVVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLK
1e2hB           --------------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPE
3ecpA           ----------------------------------------------------------------------
1ai4B           --------------------------------WYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWD
2c7cH           -------VLDKSFGAPTITKDGVSVAREIELEDKFENMGAMVKEVASKANDAAGDGTTTATVLAQAIITE
2bdtA           ------------------------------------KLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDI
1e9sJ           ----------------------------------------------------------------------
3c85A           ---------------------------------------------------------QLINPGHAQVLIL
3d31A           -----------------------------------ALVRVKVDCGVPLNVLITRRSAEEMELSPGVQIYA
3cmvE           ------------------------SLDIALGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFI
3bb1G           ----------------------------------------------------------------------
2a30A           -----------------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPV
3clvA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3c8uA           ------------------AALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVV
2bx2L           ----------------------------------------------MGLIVRTAGVGKSAEALQWDLSFR
3bo6B           ----------------------------------------------------------------------
3bczC           -------------------------VCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHA
2d3wA           ----------------------------------------------------------------------
2awoA           -------------------------------------------QIPSIRQNLVYRQNDVVLVEEGATFAI
3cmxA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2bjbA           MLDA-----LQTLGLRVDGVGSELTVSGRIEPGPGA--RVDCGLAG----TVLRFVPPLAALGSVPVTFD
2a1fF           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1ak2A           ---------------------------------PKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDM
2bhjA           ---------------------------------------------------------RIKNWGSGEILHD
3cmvB           -------DRSMDVETISTGSLSLDI-ALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFI
3cnlA           ----------------------------------------------------------------------
3ch4B           ----------------------------APLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRL
1afrA           --------------------PPREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLP
2d2eA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e2kA           ---------------------------------PTLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTY
1cr0A           ----------------------------------------------------------------------
1dekA           ------------------------------------KLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGP
2dr3D           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2a2zB           -----------------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPV
2cckB           ------------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTR
3d1mA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e9sB           -RFLRGIVSGGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV
1d6jB           ----------------------------------------------------------------------
1e2iA           --------------------------------MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASE
3b55A           ----------------------------------------------------------------------
1ek0A           ---------------------------------------VLLGEAAVGKSSIVLRFVSNDFAENKEPTIG
5dfrA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cr7A           -----------------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYR
2d2fA           ----------------------------------------------------------------------
1culC           ----------------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQD
3be4A           --------------------------------NSKKHNLILIGAPGSGKGTQCEFIKKEYGLAHLSTGDM
1b0uA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3cmtD           --------------------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFI
3dfnC           ----------------------------------------------------------------------
3d3qB           -----------------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQ
1cjaA           ---------MLECLAAIDKSFRVITTLANQANILLMELVRGITLNKLTTTSAPEVLTKSTMQQLGSLMAL
1cr2A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1cs4C           ----------------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQD
3dfqA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ------------------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSS
3dfpD           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9sE           -RFLRGTVSGGKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV
3dm5B           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3cd9A           GDTLVNRIELKGIDFKEDG-NILGHKLEYNYNCESNVYIMADKQKNGIKANFKTRHNIEDGSVQLADHYQ
1e9rG           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sL           -RFLRGIVSGGKLKRMTREKAKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1e9rF           -RFLRGIVSGGKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV
1e2lA           --------------------------------MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRV
1akeA           ---------------------------------------ILLGAPGAGKGTQAQFIMEKYGIPQISTGDM
2b0lC           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dpyB           -------LQRTPIEHVLDTGVRA---INALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLI
1e4vA           ---------------------------------------ILLGAPVAGKGTQAQFIMEKYGIPQISTGDM
3dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
2czvB           ------------------------------------EVVVSIKFNEEVDKEKLREARKEYGKVAILLSNP
1e9sH           ----------------------------------------------------------------------
1cfrA           ---------------------------------------DIISKSGEGNKYTINSAIAFVAYASHIDINT
3dymA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e2iB           ---------------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPE
1eamA           ----------------------------------------------------------------------
1cjtC           ----------------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQD
2a1fE           ----------------------------------------------------------------------
2awnA           ---------IRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAI
1e9sM           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2b8tD           -----------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYVFK
3e0cA           ----------------------------------------------------------------------
2ccjA           ------------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTR
1e2mB           ---------------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPE
3dfoC           ----------------------------------------------------------------------
2ancF           -----------------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIE
2d7vB           ANVDPEEAFVAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPT
2awoD           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dpyA           GAITPPFNPLQRTPIEHVLDTGVRA-INALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLI
2bv7A           -----------------------------------TKIKAVYDTNPTKFRTLQNILEVEKEMYGA-----
3dfqC           ----------------------------------------------------------------------
1e2jA           ---------------------------------PTLLRVYIDGPHGMGKTTTTDDIVYVPEPMTYWRVLG
3b9qA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dekB           ------------------------------------KLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGP
4atjA           ------------------------------------------------------LTPTFYDNSCPNVSNI
2e85B           ----------------------------------------------------------------------
3cm0A           -----------------------------------GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDI
3bk7A           ------------------------------GEIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWD
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2d7vA           ANVDPEEAFVAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPT
2a1fC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           --------------------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQ
1delA           ------------------------------------KLIFLSGVKRSGKDTTADFIMSNY---SAVKYQL
2an9A           ----------------------------------------------------------------------
1ckeA           -----------------------------------APVITIDGPSGAGKGTLCKAMAEAL----QWHLLD
2anbA           ----------------------------------------------------------------------
2ancD           -----------------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVS
1bccF           ----------------------------------------------------------------------
3crmA           -----------------------------------PPAIFLMGPTAAGKTDLAMALADALPCELISVDSA
3do6A           ----------------------------------------------------------------------
1e2nB           ---------------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPE
2cbzA           -------ITVRNATFTWARS-DPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKV-------
2ancB           -----------------------------------GTLYIVSAPSGAGKSS----------------LIQ
1cjuC           ----------------------------------ATHRLLLLGAGESGKSTIVKQMRILHVN--GEKATK
1c9kC           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3c14C           ----------------------------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQ
1e2hA           ---------------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYW
2b0lB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3e8aC           ----------------------------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQ
1azsC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1cjvC           ----------------------------------ATHRLLLLGAGESGKSTIVKQMRILHVEKATKVQDI
2aexA           ----------------------------------------------------------------------
1e9rB           -RFLRGIVSGGKLKRMTREKAKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV
2bhvC           ----------------------------------------------------------------------
3c7kA           ---------------------------------------LLLGAGESGKSTIVKQMKIIFSGEDVKQYKP
2bboA           ----------------------------------------------------------------------
1e2nA           ---------------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPE
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
3cmuA           MRLGDRSMDVETISTGSLSLDIALGAGGL----PMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFI
2cdnA           ----------------------------------SHMRVLLLGPPGAGKGTQAVKLAEKLGIPQIST-GE
2ax4B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3bs4A           --------------------------------KKHSLILIHEEDASSRGKDILFYILSRKLKSDNLVGMF
2a78A           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
1dw9A           -------QINRNIRLDLADA-------ILLSKAKKDLSAEIADGTGLAEAFVTAALLGQQALPADAARLV
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
3cb9A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3cddA           ---------------------GWTKIGITRSLEASGAFDLETYKFLGNDAQYKAFIQACTVDIGGERVIT
1e2jB           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
1e2mA           ---------------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMVLG
3dkvA           ---------------------------------------VLMGLPGAGKGTQAERIVEKYGI--PHISTG
1e6vC           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjF           --------------------------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST---
3cddB           ------------------------AGGKIYQGWTKIGITRSLEASGAFDLETYKFLGNDAQYKAFIEPIK
2bwjC           --------------------------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST---
3dzvA           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2dwuB           ----------------------------------------------------------------------
1dapA           --------------EVNFIDEATF--DSEHTGMPHGGHVITTGDTGGFNHTVEYILKLDRNPFTASSQIF
3cddE           --------------------------------KIYQGWTKIGITRSLEASGAFYKFLGNDA-QYKAFIEP
2dfsA           ------------------------------------------GESGAGKTVSAKYAMRYFATVSGSNVEE
2bwjE           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1e9sK           ----------GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV
2ch0A           ----------------------------------------------------------------------
1eg7B           L-----GIQEDEVELYGKYKAKILDVYRRLKDKPDGKLILVTTPAGEGKTTTSVGLTDALARLGKRVMVC
3a25A           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
2afiM           ----------------------------------------IYGKGGIGKSTTTQNLVAALAEMGKKVMIV
2ak3A           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1akyA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3b5jA           -----HDITFRNIRFRYKPD-SPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLID
2d3wB           -------LSIKDLHVSVEDKA---ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE
2dwoA           -------SRVQKIWVPVDHR----PSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVF
2c61B           LDINGAAMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFA
1e69A           ----------------------------------------------------------------------
2dwpA           ------------------------RVQKIWVPVDHRNSIVMVGLPARGKTYISKKLTRYLNWIGVPTKVF
3dmdC           KGKIIEEAVKEAVSEILE-TSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIA
2akaB           ----------------------------------------------------------------------
3eiuA           LDINGAAMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFA
2b8tA           ----------------------------------------------------------------------
1dkiA           LPVVKSLLDSKGIHYNQGNPYNLLTPVIEKVKPGEQSFVGQHAATGSVATATAQIMKYHNYPNKGLKDYT
3eiuB           LDINGAAMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFA
3bb1A           QQTVRGWSGINTFAPATQTKLL-ELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSE
3dm5A           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3c95A           SWVAPLAWHPENRNAVIMV-DLAGDISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGIN
2ccgA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3b2qA           LDINGAAMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFA
2cjwB           -----------------------------------YYRVVLIGEQGVGKSTLANIFAGVEDTYERTLMVD
2bbsA           ----TTEVVMENVTAFWEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
2ccgB           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
3b2qB           LDINGAAMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFA
3dmdB           ----------------------------------------------------------------------
3dtbB           --GGNSLLGKKCFALRIASRAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDD
1e9fA           -----------------------------------GALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELL
2ahvA           ------------VKPPGRVP--VLSAQEAVNYIPDEATLCVLGAILEATTLITALADKYISPTGLGDRAD
2c03A           LTP--AEVILATVYEALKEALGG---EARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLV
2b8wA           -------CLIENTNGRLMANPEAL--KILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQ
1bifA           -----------------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREF
2c61A           LDINGAAMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFA
2c9yA           ----------------------------------------------------------------------
2dr3A           ---------------------IPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYV
1e98A           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2c04A           LTP--AEVILATVYEALKEAL---GGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLV
2czvA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
3dt4A           SLLGKKCLRIASRLAKEEGWLEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDD
2a5gA           ----------------------------------------------------------------------
2c4rL           ---------LAGSYLVLMPNNPRAGGISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRL
2cgtH           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2ahwD           ----------KPPRINGRVPVLSA--QEAVNYIPDEATLCVLGAILEATTLITALADKYISPTGLGDRAD
2bofX           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3d7wA           GEEYFSFILLRDVSSGSFSN-NIPLLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGN
1dg3A           -------CLIENTNGRLMANPEAL--KILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCV
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2awnD           -----ASVQLQNVTKAWGEVV---VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG
3bb1B           ---VRGWSGINTFAPATQTKLL-ELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSG
2a2zD           ----------------------------------------------------------------------
2d62A           ---IGAEVKLINIWKRFGDVT---AVKDLSLEIKDGEFLVLLGPSGCGKTTTLRILEEPTRGQIYIEDNL
3b85A           -------------------RPKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIIL
1cr4A           -ERIREHSSEESVGLLFSGCT---GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGL
2dr3E           ------------------------VDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYV
3di4A           PRPDLALYRAARASARKTGEVLVPPREGRCFEVKAGQFFRISSVEGPQVGD-----LNLHNLHDLTERFF
3a1wA           -------------------------------------KVALAGCPNVGKTSLFNALTGTKQYVANWPGVT
3cddF           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3dt7A           LGKKCFALRIASRLAKEEGWLEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDD
3bb1E           ---VRGWSGINTFAPATQTK-LLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSE
3cddD           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2eg5G           SYAKNSAYNQLVLAKVKPEQCVRELLRANLPNINKCIKVADLGCASGPNTLLTVRDIVVGQLERPTIQIF
3bjdB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
1e9sG           GTRIVSGGKLKRMTREKAKQV---TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV
3bb1H           ---VRGWSGINTFAPATQTKLL-ELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSE
3bb1F           ---VRGWSGINTFAPATQTK-LLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSE
1e0jA           LRERIREHLSSSVGLLFSGCT---GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGL
1e9rA           GTRIVSGGKLKRMTREKAKQV---TVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV
1e1qB           ------------IPRISVREPTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEK
2bc9A           ----GPMCLIENTNGRLMANPEAL--KILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQ
3da4A           CNADRNLVLHPGISVYDAY------HFAKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVN
1e9sF           GTRIVSGGKLKRMTREKAKQV---TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV
3bb1D           ---VRGWSGINTFAPATQTK-LLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSE
1aroP           ----------------------------------------------------------------------
2d3wC           -------LSIKDLHVSVEDKA---ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE
3bh0A           -------SADGNITGVPSGFT---ELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLH
1e2fA           -----------------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELL
3bm2B           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2b92B           -------CLIENTNGRLMANPEAL--KILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQ
1e0jB           RERIREHSSEESVGLLFSGCT---GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGL
3ec1A           ----------------------------------------------------------EATGKGNVITTS
3cbnA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
421pA           ---------------------------------------VVVGARGVGKSALTIQLIQNHFVDEYDPTIE
2d0kA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2ctsA           ---------------------LKDILADLIEQARIKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETS
2d4hA           -------CLIENTNGRLMANPEAL--KILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQ
1e3mA           PELKEYEDKVLTSKGKALAL-EKQLYEELFDLLLPHSASALAELDLVNLAERAYTLNYTCPTFIDKPGIR
2dr3B           ------------------------VDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYV
1e3aB           ----------------------------------------------------------------------
2a5jA           -------------------------SSGLVPRGSYLFKYIIIGDTGVGKSCLLLQFTDKRFQPIGVEFGA
1e9sD           GTRIVSGGKLKRMTREKAKQV---TVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV
2bkhA           IKSYQGKSLGTMPPHVFAIAD---KAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDI
3dhwC           -------IKLSNITKVFHQGTTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVD
3bb1C           ---VRGWSGINTFAPATQTKL-LELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSE
2bbsB           ------------TEVVMENVTAFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
2a2zA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           RRKAPGIIPRISVREPMQTGI---KAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEK
3ed8A           GDTLVNRIELKGTDF----KEDGNILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLA
2d4hB           ----------------------------------------------------------------------
3cr7C           ----------------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYR
2awnC           ------------------QLQNVTVSKDINLDIHEGEFVVFVGPSGCGKST-------------------
3dm9B           KGKIIEEAVKEAVSEIL--ETSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIA
2a30D           -----------------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPV
3dffA           ----------------------------------------------------------------------
1dvrA           -----------------------------------SIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDM
2aumA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
2d3wD           -------LSIKDLHVSVEDKA---ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE
3bgwA           TVYEEIESADGNITGVPSGFT---ELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLH
2dr3C           ------------------------VDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYV
3a00A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1e6cA           ------------------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIF
2ausC           ----------------------------------------------------------------------
2dflA           FKTALEVKKERMN-VKKISTGSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGG--
3adkA           -----------------------------EEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDL
2d4uA           ----------------------------------------------------------------------
2b8wB           -------CLIENTNGRLMANPEAL--KILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQ
2a30B           -----------------------------------IKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCN
2dr3F           ------------------------VDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYV
2ck3C           RRKAPGIIPRISVREPMQTGI---KAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEK
1e59A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1e9sJ           -------GKLKRMTREKAKQV---TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV
3c85A           ----------------------------------------------------------------------
3bb1G           QQTVRGWSGINTFAPATQTK-LLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSE
2a30A           ----------------------------------------------------------------------
3clvA           ------------------------------MEKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIG
1e9rE           GTRIVSGGKLKRMTREKAKQV---TVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV
1e2gA           -----------------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELL
2bbtB           -------VVMENVTAFWEEGFGEPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
1cr1A           IREHLSSEE--SVGLLFSGCT---GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKK-VG
2c0bL           ------------ISLAGSYLVLMPNNPRAGGISRRIELKEALASLELPLIVRTAGVGKSAEALQWDLSFR
1bg0A           ------------IKNKKTGMGATLLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYHGGFKLT
2bkeA           DIRFKTALEVKKERNVKKISTGSQALDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLS
3c8uA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bo6B           NEDLKTNHSLHNQMRQMPMSH---FREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCK
3bczC           ----------------------------------------------------------------------
2d3wA           -------LSIKDLHVSVEDKA---ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE
3cmxA           --------------------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFI
2bkiA           IKSYQGKSLGTMPPHVFAIAD---KAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDI
2bjbA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3cr7D           ----------------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYR
1ak2A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cnlA           TKKWVEFFKKQGKRVITTHKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLE
3ch4B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d2eA           -------LEIRDLWASIDGET---ILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEIL
1eilA           ----------------------------------------------------------------------
2cvfA           ---------------MLSTGKSLD--SLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTE
1e2kA           ----------------------------------------------------------------------
1cr0A           -ERIREHSSEESVGLLFSGCT---GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGL
1dekA           ----------------------------------------------------------------------
2dr3D           ------------------KTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYV
2bhvA           ----------------------------------------------------------------------
1av6A           DNELDYEPESANEVAKKLPYQGQLKLLLGELFRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWM
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1d6jB           ---------------------ALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRAYRLD
1e2iA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3dlbB           --------------------------------VEGLAVYRREHARGPGWRVLGGAVLDLW----------
1ckvA           ------NAYDAGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPWIK
2drcA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2d2fA           -------LEIRDLWASIDGET---ILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEIL
1culC           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1b0uA           -------LHVIDLHKRYGGHE---VLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVN
1e9rD           GTRIVSGGKLKRMTREKAKQV---TVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV
1dhiA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1cr2A           -ERIRE--HLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGL
1bglA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2dftC           ------------------------------------PKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVA
3dfnD           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftA           ------------------------------------PKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVA
3cnnA           -KKWVEFFKKQGKRVITTHKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLEN
3a00B           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1d6jA           ----------------------LTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYR
1adoA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dfdA           -----QTIDAEEVEVPISKRFVDKEGNVVPFKAITTDRIDELEKENTTKEL-------DSQRFYARIAVE
3dfqD           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dm5B           PAGISKKEHIIKIVYEELTK-FLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVV
2bwjA           ---------------------------GFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST---
1drbA           ----------------------------------------------------------------------
1d2zD           GAGCLNFPAEIKKGFKYTAQDVF-QIDEAANRLPPDQSKSQTSGKLNERPTVGVLLQLLVLFSAADFVAL
3cioD           -------------------RALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFI
3cr7B           -----------------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYR
3dftD           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e9rG           -------GKLKRMTREKAKQV---TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV
2e85A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9sI           -RFLRGIVSGGKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV
1d8jA           ----------------------------------------------------------------------
3