[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cimm2:CIRT_10408

[Show Plain Result]

#ERROR : Can't open dsspfile "3e5uC.bssp"
#ERROR : Can't open dsspfile "3e6cC.bssp"
#ERROR : Can't open dsspfile "2bgcA.bssp"
#ERROR : Can't open dsspfile "3e5uD.bssp"
#ERROR : Can't open dsspfile "3e6bB.bssp"
#ERROR : Can't open dsspfile "3e5xB.bssp"
#ERROR : Can't open dsspfile "3d0sB.bssp"
#ERROR : Can't open dsspfile "3e5uB.bssp"
#ERROR : Can't open dsspfile "3e5xD.bssp"
#ERROR : Can't open dsspfile "1db9A.bssp"
#ERROR : Can't open dsspfile "3e5qA.bssp"
#ERROR : Can't open dsspfile "3dkwA.bssp"
#ERROR : Can't open dsspfile "3e5xA.bssp"
#ERROR : Can't open dsspfile "3e5qB.bssp"
#ERROR : Can't open dsspfile "2beoB.bssp"
#ERROR : Can't open dsspfile "3e6dB.bssp"
#ERROR : Can't open dsspfile "3e97A.bssp"
#ERROR : Can't open dsspfile "2beoA.bssp"
#ERROR : Can't open dsspfile "3dv8A.bssp"
#ERROR : Can't open dsspfile "2byvE.bssp"
#ERROR : Can't open dsspfile "3e5uA.bssp"
#ERROR : Can't open dsspfile "3e6bA.bssp"
#ERROR : Can't open dsspfile "3e6dA.bssp"
#ERROR : Can't open dsspfile "3e5qC.bssp"
#ERROR : Can't open dsspfile "2bgcH.bssp"
#ERROR : Can't open dsspfile "3e5qF.bssp"
#ERROR : Can't open dsspfile "2bgcF.bssp"
#ERROR : Can't open dsspfile "3d0sA.bssp"
#ERROR : Can't open dsspfile "2bgcB.bssp"
#ERROR : Can't open dsspfile "2bgcD.bssp"
#ERROR : Can't open dsspfile "3cf6E.bssp"
#ERROR : Can't open dsspfile "1cx4A.bssp"
#ERROR : Can't open dsspfile "3dn7B.bssp"
#ERROR : Can't open dsspfile "3cl1A.bssp"
#ERROR : Can't open dsspfile "3co2A.bssp"
#ERROR : Can't open dsspfile "2d93A.bssp"
#ERROR : Can't open dsspfile "3dn7A.bssp"
#ERROR : Can't open dsspfile "3bpzA.bssp"
#ERROR : Can't open dsspfile "3co2D.bssp"
#ERROR : Can't open dsspfile "3co2B.bssp"
#ERROR : Can't open dsspfile "3cl1B.bssp"
#ERROR : Can't open dsspfile "3clpC.bssp"
#ERROR : Can't open dsspfile "3clpA.bssp"
#ERROR : Can't open dsspfile "3co2C.bssp"
#ERROR : Can't open dsspfile "3bpzC.bssp"
#ERROR : Can't open dsspfile "3bwwA.bssp"
#ERROR : Can't open dsspfile "1bibA.bssp"
#ERROR : Can't open dsspfile "3bwgA.bssp"
#ERROR : Can't open dsspfile "3bwgC.bssp"
#ERROR : Can't open dsspfile "3bwgB.bssp"
#ERROR : Can't open dsspfile "2dk8A.bssp"
#ERROR : Can't open dsspfile "3edpB.bssp"
#ERROR : Can't open dsspfile "2di3A.bssp"
#ERROR : Can't open dsspfile "1e2xA.bssp"
#ERROR : Can't open dsspfile "2b7oA.bssp"
#ERROR : Can't open dsspfile "2acjA.bssp"
#ERROR : Can't open dsspfile "2b7oB.bssp"

## Summary of PDB Search
:221
    3e-35  16%  3e5uC  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    1e-34  16%  3e6cC  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    4e-34  13%  2bgcA  [x.x.x] PRFA
    8e-34  16%  3e5uD  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    8e-34  16%  3e6bB  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    5e-33  16%  3e5xB  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    7e-33  51%  3d0sB  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN
    9e-33  16%  3e5uB  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    2e-32  16%  3e5xD  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    3e-32  26%  1db9A  [b.82.3 - a.4.5 (1o3sA)] CATABOLITE GENE ACTIVATOR PROTEIN
    4e-32  14%  3e5qA  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    1e-31  23%  3dkwA  [x.x.x] DNR PROTEIN
    2e-31  16%  3e5xA  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    2e-31  14%  3e5qB  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    3e-31  12%  2beoB  [x.x.x] LISTERIOLYSIN REGULATORY PROTEIN
    2e-30  14%  3e6dB  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    2e-30  21%  3e97A  [x.x.x] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY
    8e-30  10%  2beoA  [x.x.x] LISTERIOLYSIN REGULATORY PROTEIN
    8e-30  20%  3dv8A  [x.x.x] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY
    1e-29  16%  2byvE  [x.x.x] RAP GUANINE NUCLEOTIDE EXCHANGE FACTOR 4
    2e-29  16%  3e5uA  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    6e-29  16%  3e6bA  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    6e-29  14%  3e6dA  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    1e-28  16%  3e5qC  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    2e-28  12%  2bgcH  [x.x.x] PRFA
    2e-28  15%  3e5qF  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    2e-28  14%  2bgcF  [x.x.x] PRFA
    7e-28  52%  3d0sA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN
    1e-27  14%  2bgcB  [x.x.x] PRFA
    6e-27  10%  2bgcD  [x.x.x] PRFA
    2e-26  16%  3cf6E  [x.x.x] RAP GUANINE NUCLEOTIDE EXCHANGE FACTOR (GEF) 4
    3e-20  30%  1cx4A  [b.82.3 - b.82.3] CAMP-DEPENDENT PROTEIN KINASE REGULATORY
    2e-19  20%  3dn7B  [x.x.x] CYCLIC NUCLEOTIDE BINDING REGULATORY PROTEIN
    1e-18  30%  3cl1A  [x.x.x] MLL3241 PROTEIN
    2e-18  29%  3co2A  [x.x.x] MLOTIK1 ION CHANNEL PROTEIN
    3e-18  20%  2d93A  [x.x.x] RAP GUANINE NUCLEOTIDE EXCHANGE FACTOR 6
    9e-18  20%  3dn7A  [x.x.x] CYCLIC NUCLEOTIDE BINDING REGULATORY PROTEIN
    9e-18  31%  3bpzA  [x.x.x] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED
    1e-17  28%  3co2D  [x.x.x] MLOTIK1 ION CHANNEL PROTEIN
    2e-16  28%  3co2B  [x.x.x] MLOTIK1 ION CHANNEL PROTEIN
    2e-16  29%  3cl1B  [x.x.x] MLL3241 PROTEIN
    2e-16  29%  3clpC  [x.x.x] MLL3241 PROTEIN
    4e-16  29%  3clpA  [x.x.x] MLL3241 PROTEIN
    4e-16  29%  3co2C  [x.x.x] MLOTIK1 ION CHANNEL PROTEIN
    5e-16  30%  3bpzC  [x.x.x] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED
    2e-15   9%  3bwwA  [x.x.x] PROTEIN OF UNKNOWN FUNCTION DUF692/COG3220
    7e-05  23%  1bibA  [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]
    8e-05  22%  3bwgA  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    1e-04  22%  3bwgC  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    1e-04  19%  3bwgB  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    4e-04  18%  2dk8A  [x.x.x] DNA-DIRECTED RNA POLYMERASE III 39 KDA
    4e-04  17%  3edpB  [x.x.x] LIN2111 PROTEIN
    5e-04  21%  2di3A  [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
    5e-04  31%  1e2xA  [a.4.5 - a.78.1] FATTY ACID METABOLISM REGULATOR PROTEIN
    6e-04  13%  2b7oA  [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE
    7e-04  25%  2acjA  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    8e-04   8%  2b7oB  [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE
:221

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxPLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAIMG
3e5uC           -----IPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3e6cC           -----IPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
2bgcA           --------AQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYK
3e5uD           -----IPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3e6bB           ----------FPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3e5xB           -----IPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3d0sB           -----GIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMG
3e5uB           -----IPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3e5xD           -----IPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
1db9A           ------------DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
3e5qA           --------NFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3dkwA           -----HLFEPLSPVQLQELLASSDLVNLDKGAYVFRQGEPAHAFYYLISGCVKIYRLTPEGQEKILEVTN
3e5xA           -----IPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3e5qB           ----------FPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
2beoB           ----------AQAEEFKKYLETNGPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYK
3e6dB           ----------FPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3e97A           -----PLFQNVPED-AREALKVVTERNFQPDELVVEQDAEGEALHLVTTGVVRVSRVSL--RERVLGDIY
2beoA           ----------AQAEEFKKYLETNGPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYK
3dv8A           -----PLWNDLNTAQKKLISDNLITQHVKKGTI-IHNGNDCTGLLLVKSGQLRTYILSDEGREITLYRLF
2byvE           -----KALSHLSTTVKRELAGVLIESHAKGGTVLFNQGEEGTSWYIILKGSVNV----VIYGKGVVCTLH
3e5uA           -----IPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3e6bA           --------NFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3e6dA           --------NFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3e5qC           --------NFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
2bgcH           --------AQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYK
3e5qF           ----------FPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
2bgcF           ----------AQAEEFKKYLETNGPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYK
3d0sA           -----GIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMG
2bgcB           --------SNAQAEEFKKYLETNGPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYK
2bgcD           --------AQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYK
3cf6E           -----KALSHLSTTVKRELAGVLIESHAKGGTVLFNQGEEGTSWYIILKGSVN----VVIYGKGVVCTLH
1cx4A           -----LLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDI-YVKCDGVGRCVGNYD
3dn7B           -----RKFIFLTDEDAGTLSAFFQLKKVRKKETLLKTGEICRINYFVVKGCLRLFFIDEKGIEQTTQFAI
3cl1A           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVE-------LG
3co2A           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVEL-------G
2d93A           -----PAFANMTMSVRRELCSVMIFEVEQAGAIILEDGQELDSWYVILNGTVEI-----SHPDGKVENLF
3dn7A           -----RKFIFLTDEDAGTLSAFFQLKKVRKKETLLKTGEICRINYFVVKGCLRLFFIDEKGIEQTTQFAI
3bpzA           -----PLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSV-----LTKGNKEMKLS
3co2D           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELG-------
3co2B           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELG-------
3cl1B           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELG-------
3clpC           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPV-------ELG
3clpA           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVEL-------G
3co2C           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVE-------LG
3bpzC           -----PLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKNKEMKL------S
3bwwA           ------LEIQISVENTSYY--LHSETSTNEVEFLNAIVQEANCGIHLDVNNIYV-------------NAV
1bibA           ----------------------------------------------------------------------
3bwgA           ----------------------------------------------------------------------
3bwgC           ----------------------------------------------------------------------
3bwgB           ----------------------------------------------------------------------
2dk8A           ----------------------------------------------------------------------
3edpB           ----------------------------------------------------------------------
2di3A           ----------------------------------------------------------------------
1e2xA           ----------------------------------------------------------------------
2b7oA           ----------------------------------------------------------------------
2acjA           ----------------------------------------------------------------------
2b7oB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXXXXXXXNDVVADLVF
3e5uC           GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
3e6cC           GNSLIGKLYPTG---NNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
2bgcA           GAFVIMSGFIDTSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSI
3e5uD           GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
3e6bB           GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
3e5xB           GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
3d0sB           PSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIF
3e5uB           GNSLIGKLYPTG---NNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
3e5xD           GNSLIGKLYPTG---NNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
1db9A           QGDFIGELGLFEEGQRSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
3e5qA           GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVPTIRI
3dkwA           ERNTFAEAMFMDTPNYVATAQAVVPSQLFRFSNKAYLRQLQDNTPLALALLAKLSTRLHQRIDEIETLSL
3e5xA           GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
3e5qB           GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVPTIRI
2beoB           GAFVIMSGFIDTETSVYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSI
3e6dB           GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVPTIRI
3e97A           APGVVGETAVLAHQERSASVRALTPV-RTLLHREHFELILRRHPRVLWNLAELARRVTFLNDEL--IAFG
2beoA           GAFVIMSGFIDTSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSI
3dv8A           DD-CLLSASCIRSIQFEVTIEAEKDTDLWIIPAEIYKGIKDSAPVANYTNELATRFSDVW----LIEQIW
2byvE           EGDDFGKLALVNDAPRAAIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVPAQQKYT
3e5uA           GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
3e6bA           GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNP
3e6dA           GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVPTIRI
3e5qC           GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAPTIR
2bgcH           GAFVIMSGFIDTETSVYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSI
3e5qF           GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEPTI
2bgcF           GAFVIMSGFIDTSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSI
3d0sA           PSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIF
2bgcB           GAFVIMSGFIDTSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSI
2bgcD           GAFVIMSGFIDTETSVGYYEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSI
3cf6E           EGDDFGKLALVNDAPRAAIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVQKYTVMS
1cx4A           NRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNN--------------------------
3dn7B           ENWWLSDYAFQKQQPADFYIQSVENCELLSITYTEQENLFERIP--------------------------
3cl1A           PGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSP--------------------------
3co2A           PGAFFGEMALISGEPWSATVSAATTVSLLSLHSADFQMLCSSSP--------------------------
2d93A           MGNSFGITPTLDKQYMHGIRTKVDDCQFVCIAQQDYWRILNHVE--------------------------
3dn7A           ENWWLSDYAFQKQQPADFYIQSVENCELLSITYTEQENLFERIP--------------------------
3bpzA           DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYP--------------------------
3co2D           PGAFFGEMALISGEPWSATVSAATTVSLLSLHSADFQMLCSSSP--------------------------
3co2B           PGAFFGEMALISGEPWSATVSAATTVSLLSLHSADFQMLCSSSP--------------------------
3cl1B           PGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSP--------------------------
3clpC           PGAFFGEMALISGEPESATVSAATTVSLLSLHSADFQMLCSSSP--------------------------
3clpA           PGAFFGEMALISGEPESATVSAATTVSLLSLHSADFQMLCSSSP--------------------------
3co2C           PGAFFGEMALISGEPWSATVSAATTVSLLSLHSADFQMLCSSSP--------------------------
3bpzC           DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYP--------------------------
3bwwA           NHGLLDPHVFIDNVDLKRVNYIHIAGTVWDLLEYTYARLSHPPTLL---ERFPPFEKLCKEVDIIHQLQQ
1bibA           ----------------------------------------------------------------------
3bwgA           ----------------------------------------------------------------------
3bwgC           ----------------------------------------------------------------------
3bwgB           ----------------------------------------------------------------------
2dk8A           ----------------------------------------------------------------------
3edpB           ----------------------------------------------------------------------
2di3A           ----------------------------------------------------------------------
1e2xA           ----------------------------------------------------------------------
2b7oA           ----------------------------------------------------------------------
2acjA           ----------------------------------------------------------------------
2b7oB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRETVNKALADFASRGWLRLEPRSVVI
3e5uC           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIV
3e6cC           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIV
2bgcA           NGKLGSICSQLLILTYVYGKETPDGKITLDNLTMQELGYSSGIAHSSVSRIISKLKQEKVIVYKNSCFYV
3e5uD           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIV
3e6bB           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIV
3e5xB           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIV
3d0sB           TDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLI
3e5uB           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIV
3e5xD           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIV
1db9A           LDVTGRIAQTLLNLAKQPDA-MTHPDGMQIKITRQEIGQIVGCSRDTVGRILKMLEDQNLISAHGKTIVV
3e5qA           LRLFYELCSSQGKRVGDTY-------EITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIV
3dkwA           KNATHRVVRYLLTLAAHAP---GENCRVEIPVAKQLVAGHLSIQPETFSRIMHRLGDEGIIHLDGREISI
3e5xA           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIV
3e5qB           LRLFYELCSSQGKRVGDTYEI-------TMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIV
2beoB           NGKLGSICGQLLILTYVYG---KETPDGIKITLDNLTMQELGYSSSAVSRIISKLKQEKVIVYKNSCFYV
3e6dB           LRLFYELCSSQGKRVGDTY-------EITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIV
3e97A           QNTEAALTHVFANLYRQRLAAGVPQ-PEVLPLGTQDIAR-TSSSRETVSRVLKRLEAHNILEVSPRSVTL
2beoA           NGKLGSICGQLLILTYVY--------GKETPDGIKITLDNLTMQELAVSRIISKLKQEKVIVYKNSCFYV
3dv8A           KSLDKRVASFLLEETSIEG-------TNELKITHETIANHLGSHREVIT-RLRYFQVEGLVKLSRGKITI
2byvE           VMSGTPEK-ILEHFLETIRLEPSLNEATDSVLNDFVMMHCVFMPNTQLCPALVAHYHAQPSQGTEQERMD
3e5uA           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENIL----DKIIV
3e6bA           TIRILRLFYELCSSQGKRV---GDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIV
3e6dA           LRLFYELCSSQGKRVGDTY-------EITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIV
3e5qC           ILRLFYE------LCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIV
2bgcH           NGKLGSICSQLLILTYVYG-------KETPDGIKITLDNLTMQELSAVSRIISKLKQEKVIVYKNSCFYV
3e5qF           RILRLFYELCSSQGKRV-----GDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIV
2bgcF           NGKLGSICSQLLILTYVYGKETPDGIKILDNLTMQELGYSSGIASSAVSRIISKLKQEKVIVYKNSCFYV
3d0sA           TDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLI
2bgcB           NGKLGSICSQLLILTYVYGKETPDGIKITDNLTMQELGYSSGIAHSSVSRIISKLKQEKVIVYKNSCFYV
2bgcD           NGKLGSICSQLLILTYVYGK------ETPDGIKITLDNLTMQELGSAVSRIISKLKQEKVIVYKNSCFYV
3cf6E           GTPEKILEHFLETIRLEPS----LNEATDSVLNDFVMMHCVFMPNTQLCPALVAHYHAQPSQGTEQERMD
1cx4A           ----------------------------------------------------------------------
3dn7B           ----------------------------------------------------------------------
3cl1A           ----------------------------------------------------------------------
3co2A           ----------------------------------------------------------------------
2d93A           ----------------------------------------------------------------------
3dn7A           ----------------------------------------------------------------------
3bpzA           ----------------------------------------------------------------------
3co2D           ----------------------------------------------------------------------
3co2B           ----------------------------------------------------------------------
3cl1B           ----------------------------------------------------------------------
3clpC           ----------------------------------------------------------------------
3clpA           ----------------------------------------------------------------------
3co2C           ----------------------------------------------------------------------
3bpzC           ----------------------------------------------------------------------
3bwwA           KYVKKRGLSWL-----------------------------------------------------------
1bibA           -------------------------------HSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVP----
3bwgA           -------------------------------LPVLETLAQFEVSKSTITKSLELLEQKGAIFQVRGS---
3bwgC           -------------------------------LPVLETLAQFEVSKSTITKSLELLEQKGAIFQVRGS---
3bwgB           -------------IATEIETYIEEHQLQQGDLPVLETLAQFEVSKSTITKSLELLEQKGAIFQVRGS---
2dk8A           -----------------------------HGITDQVIQEMPHIEAQQRAVAINRLLSMGQLDLLRSN---
3edpB           --------------------------------NETALQEIYSSSRTTIRRAVDLLVEEGLVVRKNGV---
2di3A           --------------------------------SERALSETLGVSRSSLREALRVLEALGTISTATGSGPR
1e2xA           --------------------------------AERELSELIGVTRTTLREVLQRLARDGWLTIQHGK---
2b7oA           -------------------------------LQGGDCAETFDNTEPHIRGNVRALLQAVVLTYGASPVV-
2acjA           -------------------------------TTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGT---
2b7oB           -------------------------------LQGGDCAETFDNTEPHIRGNVRALLQAVVLTYGASP---


                         .         .         .         +         .         .         .:280
query           MDIERMARRAR
3e5uC           YNLGELKHLS-
3e6cC           YNLGELKHLS-
2bgcA           QNLDYLKRYAP
3e5uD           YNLGELKHLS-
3e6bB           YNLGELKHLS-
3e5xB           YNLGELKHLS-
3d0sB           SD---------
3e5uB           YNLGELKHLS-
3e5xD           YNLGELKHLS-
1db9A           -----------
3e5qA           YNLGELKHLS-
3dkwA           LDRERLEC---
3e5xA           YNLGE------
3e5qB           YNLGELKHLS-
2beoB           QNLDYLKRYAP
3e6dB           YNLGELKHLS-
3e97A           LDLAALEALS-
2beoA           QNLDYLKRYA-
3dv8A           LDSKRLETLQR
2byvE           YALNNK-----
3e5uA           YNLGELKHLS-
3e6bA           YNLGELKHLS-
3e6dA           YNLGELKHLS-
3e5qC           YNLGELKHLS-
2bgcH           QNLDYLKRYAP
3e5qF           YNLGELKHLS-
2bgcF           QNLDYLKRYAP
3d0sA           SDSERLARRAR
2bgcB           QNLDYLKRYAP
2bgcD           QNLDYLKRYAP
3cf6E           YALNNKRR---
1cx4A           -----------
3dn7B           -----------
3cl1A           -----------
3co2A           -----------
2d93A           -----------
3dn7A           -----------
3bpzA           -----------
3co2D           -----------
3co2B           -----------
3cl1B           -----------
3clpC           -----------
3clpA           -----------
3co2C           -----------
3bpzC           -----------
3bwwA           -----------
1bibA           -----------
3bwgA           -----------
3bwgC           -----------
3bwgB           -----------
2dk8A           -----------
3edpB           -----------
2di3A           S----------
1e2xA           -----------
2b7oA           -----------
2acjA           -----------
2b7oB           -----------