[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_00332

[Show Plain Result]


## Summary of Sequence Search
    1::587
    1::431     6e-37  32%  433 aa  PF00083 Sugar_tr "Sugar (and other) transporter"
   44::133     2e-07  32%  347 aa  PF07690 MFS_1 "Major Facilitator Superfamily"
   57::174     2e-04  32%  347 aa  PF07690 MFS_1 "Major Facilitator Superfamily"(query 398->529)
    1::587

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVVAGIGFFTDAYDIFAINLAS
PF00083         -------------------------------------------------LIAILGGFLFGYDTGVIGGAA
PF07690         ----------------------------------------------------------------------
PF07690         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AMLGVVFWLDAKDKPGKIPSSADTAIKVATSGGTVIGQVGFGWLADVVGRKKMYGLELMVIIFATLAQAL
PF00083         ALLAFFFGLD--DSVGLLTGLVVSILFL----GALIGALFFGPLADRFGRKKALLLSLLLMAVGTLLIAF
PF07690         --------------------------------GYALGSPPAGPLADRFGRRRVLLLGLLLFALGSLLLAF
PF07690         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SSDSPGVSIVGLLIFWRVIMGIGIGGDYPLSSIITSEFATTKWRGAMMGAVFAMQGIGQFXXXXXXXXXX
PF00083         APN-PALLIVG-----RFLQGLGVGGESGVAPVYISEIAPPKKRG------FLVSLYQLFITLGILLAAL
PF07690         ASNS------WLLLVARFLQGLGAGGLFPAASALIADWFPPEERGRALGIFSAGGGLG------------
PF07690         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XGFKESLKTAESESQCSGVCQVAVDKMWRVVIGFGAVPGCIALYYRLTIPETPRYTFDVQRDVVKGAEDT
PF00083         VGY--------------GLSLIGGDWGWRIPFGLGAVPALLLLLGRLFLPESPRWLLS------KGRLEE
PF07690         ----------------------------------------------------------------------
PF07690         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KAYMLGKPEGSPDELQRIATLEQSQSQLQVPKASWSDFWTHYKQWKHGKVLLGTAGSWFFLDVAFYGLGL
PF00083         ARAVLRRLRGKPDVDEELAEIKEELEAEREEEASWRELFPGYRR----RLLLGVGLQFFQQLTGINAITY
PF07690         ----------------------------------------------------------------------
PF07690         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           NNSIILSAIGYTGGKDMYEIMYNTAVGNLILICAGAIPGYWVTVATVDTLGRKPIQIMGFTMLTVLFIVI
PF00083         YAPTIFESAGLSSSALLATIILGLV--NLV--------GTLIAIFLVDRFGRRPLLLIGFLGMAISLLIL
PF07690         ----------------------------------------------------------------------
PF07690         -----------------------------------------------DRFGRRRVLLLGLLLFALGSLLL


                         .         .         +         .         .         .         .:490
query           GFAYDKLLHSNNGLLALYVIAQFFFNFGPNSTTFIVPGECFPTRYRSTSHGLSAASGKVGAIIAQCVFGP
PF00083         GVA---LLDGSAGILAIAFIFLFFFAIGWGPVPWVYPAEIFPTRVRATGVGLATAVNWLGNFIVPFVF-P
PF07690         ----------------------------------------------------------------------
PF07690         AFA------SNSWLL---LVARFLQGLGPAASALIA--DWFPPEERGRALGIFSAGGGLGAAL-----GP


                         *         .         .         .         .         +         .:560
query           LVSRGAKPGSSEKPWLKHVMQIFALFMLCGLITSFLIPETKRKTLEELxxxxxxxxxxxxxxxxxxxxxx
PF00083         YLLEAIGGGT---------FLIFAVCLLAALFVYFFLPETKGRTLEEL----------------------
PF07690         ----------------------------------------------------------------------
PF07690         LLG-GLLAESLGWRWAFLILAILGLLAL--LLALLLLPE-------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00083         ---------------------------
PF07690         ---------------------------
PF07690         ---------------------------