[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_00337

[Show Plain Result]


## Summary of Sequence Search
    1::462
    3::303     e-104  65%  305 aa  PF03630 Fumble "Fumble "
    1::462

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03630         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxVAVDIGGSLAKLVYFSPELGSSADGGRLNFLNFETERIDLCIDFLKQLKENH
PF03630         ------------------IAIDIGGTLAKLVYFSPEDGR---GGRLHFIKFETSNIDECIDFLKELI---


                         +         .         .         .         .         *         .:210
query           RKLNGSAPGPLCIMATGGGAYKYYDRLKEELGVDIIREDEMECLIIGLDFFITEIPNEVFTYSETSPMEF
PF03630         -----GSPKITKICATGGGAYKFYDLFKEELGLKVIKEDEMECLIKGLNFLLKNIPDEVFTYSETDPEKV


                         .         .         .         +         .         .         .:280
query           AEARPDVYPYLLVNIGSGVSMVKVSAPRRFERVXXXXXXXXXXXXXMSLLTGARTFDEMLAMAELGDNSG
PF03630         PIDNPDIYPYLLVNIGSGVSILKVDGPDQFERVGGTSIGGGTFWGLSSLLTGIKSFEELLELAKKGDNSN


                         .         *         .         .         .         .         +:350
query           VDMLVGDIYGTDYTKIGLKSSTIASTFGKVFKMQRLAERSAQGXXXXXXXXXXXXRDVSQFRREDISRSL
PF03630         VDLLVGDIYGGDYNKIGLKGDLIASSFGKVQSNEKR----------------------KNFSPEDIARSL


                         .         .         .         .         *         .         .:420
query           LFAISNNIGQIAYLQSEKHQIKHIYFGGSFIRGHRQTMNTLSYAIRFWSKGEKQAYFLRHEGYLGAVGAF
PF03630         LYMISNNIGQIAYLHALIHNIKRIVFGGSFIRGNPQTMNTLSYAINFWSKGEKKAYFLRHEGYLGALGAF


                         .         .         +         .         .         .         .:490
query           Lxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03630         L-----------------------------------------