[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_00341

[Show Plain Result]


## Summary of Sequence Search
    1::460
    1::278     2e-74  63%  278 aa  PF06432 GPI2 "Phosphatidylinositol N-acetylglucosaminyltransferase"
    1::460

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06432         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWKKLLWVKQSYP
PF06432         ----------------------------------------------------------WKKLLWVKQSYP


                         +         .         .         .         .         *         .:210
query           DNYTDTETFLDHLQRNPRLRPYDFWPLVADFTVIVQHSSVGGQLGDPMYDIXXXXXXXXXXXXXXXIRAI
PF06432         DNYTD-ETFLEHLQRNPRVRPY-------DFWPLVADSTVIVQ------------------HVCSVVIFV


                         .         .         .         +         .         .         .:280
query           AAWYGSAIQQTTAQAPALCPVPQETTDKKSLRTWAWAISRFIQYRSLPRRQTKSALLIFCALQGLSPIXX
PF06432         VCFVG---------------IFQERVSPVSVVGWGWVGKEQLSSRLRQRLSTKSALLIYFALLGLSPILK


                         .         *         .         .         .         .         +:350
query           XXXXXXXXDSIWAMSCWLMIINVFFFDYGSGTKENQNLSXXXXXXXXXXKFPASLSTNAALMASTVLASR
PF06432         SLTKSTSSDSIWAMSCWLLLINIFFFDYGSGAGATK------------AKFPASLSTNAALMASTVLASR


                         .         .         .         .         *         .         .:420
query           LKSTTHVFSLTLFSIEVFGLFPVFRRHLRAISWRGHVLLTVSLVIAAGAAVGVTLKGGYKGMILGILIGA
PF06432         LPSTTHVFSLLLFSIEVFGLFPVFRRHLRHISWRGHVLLTVLLVIIAGAAVG---RGGLSAALLGLFLGL


                         .         .         +         .         .         .         .:490
query           PSTALAMGGCSWWLIRLQKYKNVVAGPWDxxxxxxxxxxx
PF06432         --LVFISFVCPWWLISLQKYKNEIHGPWD-----------