[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_00357

[Show Plain Result]


## Summary of Sequence Search
    1::755
    1::341     5e-21  32%  347 aa  PF07690 MFS_1 "Major Facilitator Superfamily"
   38::173     2e-09  24%  526 aa  PF06609 TRI12 "Fungal trichothecene efflux pump (TRI12)"
   34::181     2e-08  29%  433 aa  PF00083 Sugar_tr "Sugar (and other) transporter"
    1::755

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         ----------------------------------------------------------------------
PF06609         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         ----------------------------------------------------------------------
PF06609         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxLLSLGFYCMIGGGMTPILAAAFNDVSEEYNVSFQKVALTTGLYMLGL
PF07690         -----------------------LLLLGYF--LSGLDRSILSPALPALAEDLGLSPSQVGLLLSAFLLGY
PF06609         -----------------------------------------------------------SLFSTLWTLGQ
PF00083         ----------------------------------------------------------VGLLTGLVVLGA


                         .         .         .         +         .         .         .:280
query           GIGSVVMSPTAILFGKRPVYIAGATMFIISAVWCALSPTYVSLVIARIFQGIAVSPVECLPSATIAEIFF
PF07690         ALGSPPAGPLADRFGRRRVLLLGLLLFALGSLLLAFASNSWLLLVARFLQGLGAGGLFPAASALIADWFP
PF06609         AVSILVVGRLSDRFGRRPFVIAGHILGLVGAIVGCTANTFNTLIAGMALLGVGAGPAELSP-LFIGELMS
PF00083         LIGALFFGPLADRFGRKKALLLSLLLMAVGTLLIAFAPNPALLIVGRFLQGLGVGGESGVAPVYISEIAP


                         .         *         .         .         .         .         +:350
query           LHERAYRVGIYTXXXXXXKNLIPLVSAAITEGLGWRWIFWVVAITIAFGLVLVFFFVPETxxxxxxxxxx
PF07690         PEERGRALGIFSAGGGLGAALGPLLGGLLAESLGWRWAFLILAILGLLALLLALLLLPE-----------
PF06609         NKTKFLGLLVVSIPTIVATFAGPYLAQRLSIQGNWRWIFYIYIIWSAIALVLIVVF--------------
PF00083         PKKRGFLVSLYQLFITLGILLAALVGSLIGGDWGWRIPFGLGAVP-ALLLLLGRLFLPES----------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         ----------------------------------------------------------------------
PF06609         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         ----------------------------------------------------------------------
PF06609         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         ----------------------------------------------------------------------
PF06609         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxKESYNFSALATGLVYISPFVGGILGTVVAGKVSDIIVRWMARRNGGIYEPEFRLVMSAPIAI
PF07690         --------QEVLGFSALQAGLLLALGGLVGAIGSLLGGRLSDRL------------GPRRRLLLGLLLLL
PF06609         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           CTAMGLMGFGWSAQEKEKWIVPTVFFGILSFGCTLGSTTSITFCVDSYRQYAGEALVTLNFSxxxxxxxx
PF07690         LGALGLLLLGLTS--SPVWLL--VALALLGFGLGLAFPALLALLSDLVPEYAGTALGLLNFA--------
PF06609         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         -------------------------------------------------------
PF06609         -------------------------------------------------------
PF00083         -------------------------------------------------------