[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_00379

[Show Plain Result]


## Summary of Sequence Search
    1::390
   23::92      3e-16  54%   97 aa  PF00153 Mito_carr "Mitochondrial carrier protein"
    5::94      4e-13  46%   97 aa  PF00153 Mito_carr "Mitochondrial carrier protein"(query 53->165)
   25::93      9e-12  51%   97 aa  PF00153 Mito_carr "Mitochondrial carrier protein"(query 197->269)
    1::390

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPWAHFFAGAVGGMTAATL
PF00153         ----------------------------------------------------------------------
PF00153         ----------------------------------------------------PLQSLLAGALAGAVAALV
PF00153         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TSPLDVLKTRLQSDFYQAQLRSLRAAHPLPQSHSILSLSRSAMVHFSETVQILRSIHVHEGWRALFKGLG
PF00153         ----------------------------------------------------------------------
PF00153         TYPLDVVKTRLQA-----------------------SAAAGAGGKYKGTLDALRKIYREEGIRGLYRGLG
PF00153         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           PNLTGVVPARAINFYVYGNGKRILNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPIWLVKTRLQLDKS
PF00153         ----------------------------------------------------------------------
PF00153         PTLLRVIPYSAIYFGTYEYLKRLLS---------------------------------------------
PF00153         --------------------------------------------------------PLDVVKTRLQ----


                         .         .         .         +         .         .         .:280
query           NASNIPGRGRQYKNSLDCIRQTVRHEGIRGLYRGLTASYLGVTESSLQWVMYEEMKRILxxxxxxxxxxx
PF00153         ----------------------------------------------------------------------
PF00153         ----------------------------------------------------------------------
PF00153         -ASAAAGAGGKYKGTLDALRKIYREEGIRGLYRGLGPTLLRVIPSAIYFGTYEYLKRLL-----------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTYPHEVVRTRLRQAPTIPAGGGKVQMKYTGLMQCFRVIWK
PF00153         ------------------------------TYPLDVVKTRLQASAAAGAGG-----KYKGTLDALRKIYR
PF00153         ----------------------------------------------------------------------
PF00153         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EEGMAGLYGGLTPHLLRVVPSAAIMFGMYEMILRLxxxxx
PF00153         EEGIRGLYRGLGPTLLRVIPYSAIYFGTYEYLKRL-----
PF00153         ----------------------------------------
PF00153         ----------------------------------------