[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_00384

[Show Plain Result]


## Summary of Sequence Search
    1::406
    1::68      4e-04  34%   71 aa  PF00076 RRM_1 "RNA recognition motif. (a.k.a. RRM, RBD, or RNP
    1::406

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00076         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLYISDLYWWTTDDEIRGWINATGCEGELKD
PF00076         ----------------------------------------LFVGNLPPDVTEEDLRELFSKYG---PVES


                         +         .         .         .         .         *         .:210
query           VTFSEHKVNGKSKGQAFVEFTSPQAATAAKHQIESLNAAQQSARxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00076         VRIVRDRETGRSKGFAFVEFESPEDAEKA---LEELNGKELGGR--------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00076         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00076         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00076         --------------------------------------------------------