[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_00411

[Show Plain Result]


## Summary of Sequence Search
    1::1056
    1::190     2e-42  61%  192 aa  PF01608 I_LWEQ "I/LWEQ domain"
    3::274     3e-31  39%  274 aa  PF07651 ANTH "ANTH domain"
   16::172     6e-04  35%  294 aa  PF09728 Taxilin "Myosin-like coiled-coil protein"
    1::1056

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxDLAVNIRKATSIEETAPKRKHVRSCIVYTWDHKSSASFWAGMKVQPVLAD
PF01608         ----------------------------------------------------------------------
PF07651         --------------------DLEVAIVKATSHDEAPPKEKHVREILSLTSSSRASACVWALSRRLPKTRN
PF09728         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EVQTFKALITVHKVLQEGHPITVKEAQSHVPWLDSLVRGVAGEGLRGYGPLIREYVFYLESKLAFHRQHP
PF01608         ----------------------------------------------------------------------
PF07651         WVVALKALILIHRLLREGDPIFLQELLSYNRRGRRLLNLSDFDDSHSYSAFVRTYALYLEERLEFHRKLK
PF09728         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EFNGLFEYEEYISLKSINDPNEGYETITDLMALQDQIDAFQKLIFSHFRGGANNECRISALVPLVQESYG
PF01608         ----------------------------------------------------------------------
PF07651         -----FDFERSERGSAIEDP---VERTMDLEDLLDELPALQKLLDRLLTGAANNECILAALYLLVKDSFK
PF09728         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IYKFITSMLRAMHTTTGDEEALEPLRGRYDAQHYRLVRFYYECSNLRYLTSLITVPKLPQQPPNLLAEDE
PF01608         ----------------------------------------------------------------------
PF07651         LYAAINEGLINLLEKFFDMSKPDAVKARFAKQTDRLVEFYKVCKNLGYLRSL-EIPKLPQAPPSLLEALE
PF09728         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DRPALxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01608         ----------------------------------------------------------------------
PF07651         EYLAL-----------------------------------------------------------------
PF09728         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01608         ----------------------------------------------------------------------
PF07651         ----------------------------------------------------------------------
PF09728         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKYEALAKLYSQLRQEHLDLLQTTKSLKLKAASAQEAIDK
PF01608         ----------------------------------------------------------------------
PF07651         ----------------------------------------------------------------------
PF09728         -------------------------------KLEALCKKYAELLEEHKRLQKELKKLQKKQEQLQKARDK


                         *         .         .         .         .         +         .:560
query           RERLEREMKTKNLELADMIRERDRALHEKDRISGGNXXXXXXXXXXXXXAIERAENAERAKSSEISAMLS
PF01608         ----------------------------------------------------------------------
PF07651         ----------------------------------------------------------------------
PF09728         LESLCRELQRHNKTLKEENKRRAREEEEK-----------------------RKELSEKFQSTDIQAQLE


                         .         .         .         *         .         .         .:630
query           KYNREMADLEEALRNKNRALEEARNSTGERDHDHELTLREKDEEIEVYKSGMEQAxxxxxxxxxxxxxxx
PF01608         ----------------------------------------------------------------------
PF07651         ----------------------------------------------------------------------
PF09728         EQNNENAKLREENEELREKLKELIEQYELREEHFEKLLKQKELEQQLLDAKLEQA---------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01608         ----------------------------------------------------------------------
PF07651         ----------------------------------------------------------------------
PF09728         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01608         ----------------------------------------------------------------------
PF07651         ----------------------------------------------------------------------
PF09728         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01608         ----------------------------------------------------------------------
PF07651         ----------------------------------------------------------------------
PF09728         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxIHDSILEASIAVTTAIAELIKAATASQQEIVREGRGSSSRTAFYKKNNR
PF01608         ---------------------VNEQILEAAKAIMAAIAALVKAATAAQREIVAQGKVAS-RPEFYKKNSR
PF07651         ----------------------------------------------------------------------
PF09728         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           WTEGLISAAKAVATSTNTLIETADGVISGRNSPEQLIVASNDVAASTAQLVAASRVKATFMSKTQDRLET
PF01608         WTEGLISAAKAVAAATNVLVEAADKVVQGTGSEEELIVAAKEVAASTAQLVAASRVKADPDSKTQDRLQA
PF07651         ----------------------------------------------------------------------
PF09728         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           ASKAVGAACRALVRQVQAIIAEKNRDETEAVDYSKLSGHEFKVREMEQQVEILQLENKLSQARQRLGEMR
PF01608         ASKAVKKATDNLVAAVKSAIEQK--EEEEDVDFSKLSLVQGKAQEMEAQVEILELEKELEEARKKLGEIR
PF07651         ----------------------------------------------------------------------
PF09728         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           KISYxx
PF01608         KQHY--
PF07651         ------
PF09728         ------