[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_00742

[Show Plain Result]


## Summary of Sequence Search
    1::241
    1::42      2e-10  76%   42 aa  PF10590 PNPOx_C "Pyridoxine 5'-phosphate oxidase C-terminal
    1::241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10590         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10590         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWGGVRLVPESVEFWQGRKSRLHD
PF10590         -----------------------------------------------WGGYRLVPESVEFWQGRPSRLHD


                         .         .         .         +         .         .         .:280
query           RFRYVRVHGENEHLGEGDEKTFRWRIQRLSP
PF10590         RFRYRRVAEDG------------WVIERLAP