[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_01210

[Show Plain Result]


## Summary of Sequence Search
    1::551
   13::107     9e-05  32%  108 aa  PF00581 Rhodanese "Rhodanese-like domain"
    1::551

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00581         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00581         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00581         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00581         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00581         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxIMIIDCRFEYEYEGGHINGAVNYTDKEHLAAELFDQEPKPSTALIFHCEYSAH
PF00581         -----------------VVLLDVRSPEEYAEGHIPGAVNLLSKDELAAALAAAELDKDKPIVVYCRSGIR


                         .         .         +         .         .         .         .:490
query           RAPIMAKYIRHRDRAVNVDIYPKLTYPEMYILNGGYSSFFAxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00581         SGAAAAAWLK------------ELGFPNVYVLDGGWKAWAA-----------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00581         -------------------------------------------------------------