[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_01225

[Show Plain Result]


## Summary of Sequence Search
    1::252
    1::71      4e-16  45%   71 aa  PF00076 RRM_1 "RNA recognition motif. (a.k.a. RRM, RBD, or RNP
    1::252

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00076         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLFCGNLAGEVTDDSLLKAFSKYP
PF00076         -----------------------------------------------LFVGNLPPDVTEEDLRELFSKYG


                         +         .         .         .         .         *         .:210
query           SVQKARVIRDKRTEKSKGYGFVSFSDGEDYFRAAREMQGKYIGSHPVLxxxxxxxxxxxxxxxxxxxxxx
PF00076         PVESVRIVRDRETGRSKGFAFVEFESPEDAEKALEELNGKELGGRPIL----------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00076         ------------------------------------------