[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_01292

[Show Plain Result]


## Summary of Sequence Search
    1::1300
   12::166     3e-05  24%  188 aa  PF05335 DUF745 "Protein of unknown function (DUF745)"
   61::177     5e-05  26%  668 aa  PF05557 MAD "Mitotic checkpoint protein"
  496::646     1e-04  19%  677 aa  PF05911 DUF869 "Plant protein of unknown function (DUF869)"
  187::499     2e-04  24%  582 aa  PF05622 HOOK "HOOK protein"
  167::314     3e-04  30%  387 aa  PF07888 CALCOCO1 "Calcium binding and coiled-coil domain (CALCOCO1)
  330::409     4e-04  30%  447 aa  PF03961 DUF342 "Protein of unknown function (DUF342)"
   81::720     4e-04  21%  794 aa  PF01576 Myosin_tail_1 "Myosin tail"
   39::215     5e-04  18%  229 aa  PF09325 Vps5 "Vps5 C terminal like"
   45::157     8e-04  27%  314 aa  PF04582 Reo_sigmaC "Reovirus sigma C capsid protein"
    1::1300

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05335         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07888         ----------------------------------------------------------------------
PF03961         ----------------------------------------------------------------------
PF01576         ----------------------------------------------------------------------
PF09325         ----------------------------------------------------------------------
PF04582         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05335         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07888         ----------------------------------------------------------------------
PF03961         ----------------------------------------------------------------------
PF01576         ----------------------------------------------------------------------
PF09325         ----------------------------------------------------------------------
PF04582         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05335         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07888         ----------------------------------------------------------------------
PF03961         ----------------------------------------------------------------------
PF01576         ----------------------------------------------------------------------
PF09325         ----------------------------------------------------------------------
PF04582         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05335         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07888         ----------------------------------------------------------------------
PF03961         ----------------------------------------------------------------------
PF01576         ----------------------------------------------------------------------
PF09325         ----------------------------------------------------------------------
PF04582         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLVRGKHQLQTDLRHLKCGTDHL
PF05335         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07888         ----------------------------------------------------------------------
PF03961         ----------------------------------------------------------------------
PF01576         ------------------------------------------------LQRVKQKLEKEKSELKMELDDL
PF09325         ----------------------------------------------------------------------
PF04582         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SKAVTQQRAELASMQAKFTVLEQSLALRDNRLENSEKLLEREKNHTSTLEAFIRNHSNRGLKQIALLQQT
PF05335         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07888         ----------------------------------------------------------------------
PF03961         ----------------------------------------------------------------------
PF01576         ASNLEQVQKAKANAEKKCKTLEDQLSELKAKLDELERQLNDLTAQKARLQAE-NSELSRQLEEAESQVSQ
PF09325         ----------------------------------------------------------------------
PF04582         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           QTETASNVGNLAEGIKNLLTESQSTIKVELGLQLKPCLEILETLSKPESIDLAQLAQIDKALRDISMKVD
PF05335         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07888         ----------------------------------------------------------------------
PF03961         ----------------------------------------------------------------------
PF01576         LSRGKSSLESQLEELKRQL-EEETRAKNALAHALRQLEHELDLLREQLEEEQEAKAELERQLSKANSELA
PF09325         ----------------------------------------------------------------------
PF04582         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           SQNQKTELHVASGFDVQNQQASRIIQQLSDMRVFFEESSTASIKLADTKQTNGMLQEKVKIAEATLAQIN
PF05335         ------------------QKASSIAQKAAQEAKAANDAQAAAAEAAAQQVKNQLADKAAQAAKAAEAALA
PF05557         --------------------------------------------------------KKNQELEARLKRLR
PF05911         ---------IKKNFLWDSSETTECKELLEELEQLKSEKENLEMRLAKCTDDIEELKNQLKESEQLLEELK
PF05622         ------------------------------------------------------LAQECKELEKQVEDLH
PF07888         ------------------------------------------------------LRSRVDRLERELAHEK
PF03961         ----------------------------------------------------------------------
PF01576         QWKKKYETEAIQRTEELEEAKKKLAQRLQEAEEQLEE---ANAKCASLEKTKQRLQQELEDLMVDLERAN
PF09325         -----------------SKKAERLVKHRKELAEATGELGKSLAKLSKSEEETGLSRALSKLAEAAEKISD
PF04582         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           VENAILKETESSLRNDVSALQKEVESLQNQLADACQSSEDRHELSKLRIQFKEISAVLDDATAKLKAKEE
PF05335         GKQQILEQLEQEVREAEAVVQEELASLQSAQANA---NAAQAAAKQAQNQLEVLTALLKNAKANLENAEQ
PF05557         KREEELEEELDEAQEELEQLKRKLEREKRRLQREKEQEEAREEQSQLKNELEELKREAQDLERQLKSLEE
PF05911         SELESLKESNSLAETQLKCMKESYESLETRLTLEAEVNELQQKISSLEVELEDEKQCHEELLAKCLELEE
PF05622         DELARLQEENDTLQERLSSLEGSSEGPSQHLAK--RLADLRAQLERLREELRRLEEALDDLEIRAEQLEK
PF07888         EECEQLKEQQKELQESSEALTEERDELKRQQEEARARTQKATELEKLKDQLKKLQAELEQLEAELKER--
PF03961         -----LKEKLSELKEEIEELKEELEKLKKNLKKLAQDSEKKEQYKKIIKTKKELNSELNELKNELKELKE
PF01576         AAAAELEKKQRKFDKVLAEWKQKVEELQAELEAAQKEARELSELFKLKNALEEALEQLETLERENKNLQD
PF09325         LLERQASADDLTLGEPLREYLRLIGSVKAALTDRAKAETAQQELAKKRAQLEKLEAASESRPDKIEEAKE
PF04582         -----LSESVSSLSSTLSDLSSDLQDLTVSLADVTSETALQDSVSSLSTSVTDLSNTVSAHSSSLSSLQS


                         .         +         .         .         .         .         *:700
query           EVSKLEAGLSETKSRLQNSETQILNLETEKAKFEKDTISIENRVRAEFTKASLLSTEQNRAWFEQQLYQI
PF05335         VASGAQQELAEKTQLLEAAKNRVEVLERQLAEARQD----------------------------------
PF05557         ELEELKEQLEELQARLQEAEEKLQSLQAAQA---------------------------------------
PF05911         QLERNEKEESDEDPKIKQEE--------------------------------------------------
PF05622         EIDELRQENEELRSKAQRA--QALKDELDELREEADRLDLENEVESQDLKKQVKELEEQNADLLQQKAML
PF07888         --------LKDTVAQLKDLETQAQRLQAELEALKEQLRKLQEQLQASQQEAELLGEELSSA---------
PF03961         ELERGKEG--------------------------------------------------------------
PF01576         ELEDLTSQLGEGGKSVHELEKAKRRLEAEKEELQAALEEAEAALEAEEQKKLRLQLEQLRAEIERRLQEL
PF09325         ELDEAERAVEQAKKEFERISE---NMKKELERFEKERVADFKNMLKEYAESQI-----------------
PF04582         SVDALSTDVSNLKSDVSSQSLQITDLEDRVAALESGASSI------------------------------


                         .         .         .         .         +         .         .:770
query           KREKATAEKSANMLKEQTXXXXXXXXXXXXXXXELEITVTENAKMMNDLESTRQEEITDLDEVVFKLKDE
PF05335         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF05622         EEQLKRARARRVQLEEYKREIQELEQKLSEEQLEKDQLEFENHALTEKLESLEEEKLEERDELRERIEEL
PF07888         ----------------------------------------------------------------------
PF03961         ----------------------------------------------------------------------
PF01576         QREIESLQAELEAERKSRAEALREKKKLEGDLNELEIQLAEAQKQLKKLQAQLKDLQRELDEAQRAREDA
PF09325         ----------------------------------------------------------------------
PF04582         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           KTFHAMDAEEAKSSLQRALAENAKMKIELVEAQSWMESSCQLSLLQEKFDLMRDESVQKDENIAFLTNEI
PF05335         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF05622         ECGQASQGSLSKSDLSSASGDNLSAELEPAELRERL-----LRLEHENKRLREEQEGLKSERIEELQE--
PF07888         ----------------------------------------------------------------------
PF03961         ----------------------------------------------------------------------
PF01576         KEQLAIAERQAELEELRAALEQAERARKQAE-QELEEASERLNELHSQNTSLLNEKRKLEADLAQLQSEL
PF09325         ----------------------------------------------------------------------
PF04582         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           ATLKDNATVTERLREEAAQGTXXXXXXXXXXXXAHKENMELTERLKSRDDDTACRTAELDLSKQEENMVN
PF05335         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF05622         -LLEDANKKKEKLEEE------------------------------------------------------
PF07888         ----------------------------------------------------------------------
PF03961         ----------------------------------------------------------------------
PF01576         EEEQSEAEAAEEKAKKAIAQAAQLAEELRAEQETSAHLERMKKNLERQVKELQHRLDELALKGGKKQIQK
PF09325         ----------------------------------------------------------------------
PF04582         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           LHQTIRGKDSELQKLQGRLDRAEESLTKIEGLLRQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05335         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07888         ----------------------------------------------------------------------
PF03961         ----------------------------------------------------------------------
PF01576         LEARIRELEEELEAEQRRHAEAQKGLRKLERRVKE-----------------------------------
PF09325         ----------------------------------------------------------------------
PF04582         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05335         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07888         ----------------------------------------------------------------------
PF03961         ----------------------------------------------------------------------
PF01576         ----------------------------------------------------------------------
PF09325         ----------------------------------------------------------------------
PF04582         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05335         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07888         ----------------------------------------------------------------------
PF03961         ----------------------------------------------------------------------
PF01576         ----------------------------------------------------------------------
PF09325         ----------------------------------------------------------------------
PF04582         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05335         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07888         ----------------------------------------------------------------------
PF03961         ----------------------------------------------------------------------
PF01576         ----------------------------------------------------------------------
PF09325         ----------------------------------------------------------------------
PF04582         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05335         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07888         ----------------------------------------------------------------------
PF03961         ----------------------------------------------------------------------
PF01576         ----------------------------------------------------------------------
PF09325         ----------------------------------------------------------------------
PF04582         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05335         ----------------------------------------
PF05557         ----------------------------------------
PF05911         ----------------------------------------
PF05622         ----------------------------------------
PF07888         ----------------------------------------
PF03961         ----------------------------------------
PF01576         ----------------------------------------
PF09325         ----------------------------------------
PF04582         ----------------------------------------