[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_01300

[Show Plain Result]


## Summary of Sequence Search
    1::908
    1::226     1e-41  46%  227 aa  PF10033 ATG13 "Autophagy-related protein 13"
    1::908

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQNYHTKAALVILHSRVDLSPATYHGVIRTNKWFNVEVNETEDLKDSLGVWKYSNCTDSRPPPLIIEVYL
PF10033         IQEFFLKAAQIILQSRLPSSSSTAASSSKGNKWFNLELEESPAVREELKLWR-SGDLESRLPPLVIEVYL


                         .         .         *         .         .         .         .:140
query           DLTQLTNNQSLVIIDDSGKRWDVVEALATYGCLDNSRTSKSGVILERWRIXXXXXXXXXXXXXXSILPTV
PF10033         DTSGLTSNQSLVLLDENGKRWDVLE----------SKTEKSEVVLERWVVELDESPGPDSPSDLGVLPTV


                         +         .         .         .         .         *         .:210
query           YKKSIVVFRSLYAYSKLLPAWKYSKRHSKIRPNPALSLKYRILQGPGGQIRSTNDPLTVPLHPGNGPVVD
PF10033         YKRSIVLLRSLYTLTRLLPAYKLFKRLSS-GSGPSLSIGYRILDGSPPISSLGEIGLSKPLIRGEEAHME


                         .         .         .         +         .         .         .:280
query           TYSFGVTDSPAGPLSALVTYRTNCDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10033         TYSFGPVETPVGRLSISVSYRTNLD---------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10033         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10033         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10033         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10033         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10033         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10033         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10033         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10033         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10033         --------------------------------------------------------------------