[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_01629

[Show Plain Result]


## Summary of Sequence Search
    1::694
    2::153     3e-26  47%  190 aa  PF06371 Drf_GBD "Diaphanous GTPase-binding Domain"
    1::694

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06371         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06371         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKPVDPKE
PF06371         ---------------------------------------------------------------KSPDDDE


                         .         .         .         +         .         .         .:280
query           IDSEFERLLDARNIPHNMRDRMRSLNTNIKADFINKNQIEGECSSASASAQRQFVTTSHKRTKSKDSSFG
PF06371         VEQLFEELLDKRNLPEDKRKKLRSLDTEKKWELICQDRL-----------------TQAKGPTSSDSSKS


                         .         *         .         .         .         .         +:350
query           RSENRGTKKRPKSADLSIPSRLPSGGLNPALPSPDLIADPTDFVHYLKEVQKPEIVEVSKLHKLRILLRN
PF06371         NKDKSGS--------------------------------PEWFVKYLKEGSKPE--NVGKLHKLRVLLRT


                         .         .         .         .         *         .         .:420
query           ETISWVESFISHGGMEQLVDLLYRILKVEWRXXXXXXXXXXXXXCIKALCTTSPALxxxxxxxxxxxxxx
PF06371         ETVSWVDEFIEAGGLDALVELLSRIMKKEWREDHEDDLEHELLRCLKALMNTSYGL--------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06371         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06371         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06371         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06371         ----------------------------------------------------------------