[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_01668

[Show Plain Result]


## Summary of Sequence Search
    1::628
    4::89      9e-22  50%   92 aa  PF00686 CBM_20 "Starch binding domain"
   24::224     5e-05  27%  402 aa  PF00723 Glyco_hydro_15 "Glycosyl hydrolases family 15"
    1::628

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGIVVA
PF00686         ----------------------------------------------------------------------
PF00723         -----------------------------------------------------------------GLFPA


                         .         .         *         .         .         .         .:140
query           SPSRADPDYFYTWTRDAALVFKHLIDAFVAGNHDSQDRIHEYITAQSYLQTVSNPSGTLSTGGLGEPKFH
PF00686         ----------------------------------------------------------------------
PF00723         SPTTSHPDYRYAWVRDNV----YCILALWGLGYRDEDRAKCYELEQSLMAMMRQKDKVEKFKETQSPSLH


                         +         .         .         .         .         *         .:210
query           VDQSAFTGSWGRPQADGPALRATAMITYAKWLIANGHEDAAKSIVWPVVQNDLSYVGQFWNSTGFDLWEE
PF00686         ----------------------------------------------------------------------
PF00723         AKYYSKNGEWGHLQIDATSLYLLALAQ----MTASGLQIVFTLDEVSFIQNLVFYIESAYRIPDYGIWEE


                         .         .         .         +         .         .         .:280
query           VQGSSFFTAIAQHRALAEGNNLARQLGTDCPHCESQAPQILCFLQxxxxxxxxxxxxxxxxxxxxxxxxx
PF00686         ----------------------------------------------------------------------
PF00723         NHGEPELNAIGMAKAALEAMNEADLFGADAQLWHNTADAILSRLQ-------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00686         ----------------------------------------------------------------------
PF00723         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00686         ----------------------------------------------------------------------
PF00723         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00686         ----------------------------------------------------------------------
PF00723         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYE
PF00686         -----------------------------VTFRVNATTQPGESVYVVGSIPELGNWDPSKAVPLTWS--E
PF00723         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           ASCPLWSIQIDLAAGKKFDYRYIRKSDDGRVVWESDPNRSYTVPKNLxxxxxxxxxxxxxxxxxxxxx
PF00686         GSYPLWTATVELPAGTTFEYKYVIKDADGNVIWESGPNRVLTVPEVL---------------------
PF00723         --------------------------------------------------------------------