[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_01675

[Show Plain Result]


## Summary of Sequence Search
    1::270
    2::114     1e-10  45%  114 aa  PF10349 WWbp "WW-domain ligand protein"
    1::270

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10349         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGGGIPPSNTAVQVKM
PF10349         -------------------------------------------------------GGGWPGS---AQFKL


                         +         .         .         .         .         *         .:210
query           TFKEGGAFDFHSAFERIKERLQQVVEQARENGMISERSSQRDGAYSGVNFTNVHLDELPAYEGXXXXXXX
PF10349         TFKEGGAIEFGQAFLRAAERAQQAVEVARESG----------GGGYPVNFANVHLEPLPAYGGYGAPPPA


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXDLHSSQNTRHTPHEERFDPPTEPPPGYEEAQQxxxxxxxxxxxxxxx
PF10349         YGPPPPGYGPPP----GVYPPQPAPNSVYMSDPTEPPPPYPEVQE---------------