[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_01687

[Show Plain Result]


## Summary of Sequence Search
    1::385
    2::221     2e-58  61%  222 aa  PF06999 Suc_Fer-like "Sucrase/ferredoxin-like"
    1::385

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06999         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxLYGHVKGWATHVLVATGKTDWVRDVADEKGSVMEAIERGGVSAKNGALKLSAS
PF06999         -----------------LYGTVKPYATHVLVATGKTDWPRDVADEK-SLPEALAEA-LKARKGKLKPGIL


                         +         .         .         .         .         *         .:210
query           NIPVPDEYYHHPEGEQPTTVLLLPAFTIIDHVTPALVPNLIRQFVDLSPTTTTPLSDVMQIAGQEEPTEQ
PF06999         LSISPGRVSNDDTGSQPTSVLLLPDFKYVPSVTPALVPEFVEYLLDLDLTATALL--------------R


                         .         .         .         +         .         .         .:280
query           TPSDINIPERPPLDLKDLSESLPTSLRSRPCSHAAVILLCSQKTRDARCGQSAPLLRREFERHLRPLGLY
PF06999         SPS--------------LSASTPPG--ARPCPHSPVILVCSHGTRDARCGISGPLLRKEFERHLRELGLY


                         .         *         .         .         .         .         +:350
query           RDLHDERPGGVGIYFISHVGGHKYSANVIVYRRRNFEWFKEGKDDCSNNVESMEKEGASQGIWLARVRPE
PF06999         RDR--------GVWFISHVGGHKFAANVIIY--------------------------SPQGIWYGRVTPE


                         .         .         .         .         *         .         .:420
query           DCEGIVKFTVLQGKVVKPGLQLRGGxxxxxxxxxx
PF06999         DVEGIVEETILQGKVVKP--LFRGG----------