[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_01746

[Show Plain Result]


## Summary of Sequence Search
    1::195
    1::137     9e-34  68%  144 aa  PF09774 Cid2 "Caffeine-induced death protein 2"
   88::155     2e-04  40%  189 aa  PF11846 DUF3366 "Domain of unknown function (DUF3366)"
    1::195

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxCFNQRALRDFLRISRSTIDDSITQNLNALVTPARKGFDPASTTARQTDFANKTQI
PF09774         ---------------CLDFSLFRDFLRLSRK-IDDSITQRLNALVTTASFGGDVAESTCR--DFWES---
PF11846         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DPENCEIFKNKVLFPSWQVRSDVLNYCAGVATSPDPEDPDLVLRQVESAKDRERLVDERLDPYSARFFPR
PF09774         ------------LFPSWQSRSDVINYCITVAASPDPEDPDLILN--ESAKLRERRVDERLDPYAARFFRR
PF11846         -PANPEILKRVTNPLLWQDRPDFDDYAAALLLGITPQDPALLLAYLEWA---EKLLKYR---------PR


                         +         .         .         .         .         *         .:210
query           EARTESLAMLIRNERGVETIIRSRTWGMVTERCxxxxxxxxxxxxxxxxxxxxxx
PF09774         E--TESLLNWLQNELSVESIIRARTWKVFNERC----------------------
PF11846         PAVYRRLALLL--------------------------------------------