[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_02192

[Show Plain Result]


## Summary of Sequence Search
    1::682
    5::107     5e-11  39%  122 aa  PF09405 Btz "CASC3/Barentsz eIF4AIII binding"
    1::682

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09405         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSEHDASPDLSDKATRLPQSQ
PF09405         --------------------------------------------------STDDSDKDSAQSGDGSEEAE


                         +         .         .         .         .         *         .:210
query           RRRREQTENGKERGANPAFVPTRGGFFLHDKRSSNSPNGYRTANNKLKSKPHGLIVDSNVRRPPPKPDIT
PF09405         RKDREEEEYDDEDRSNPAFVPTRGSFFEHDDRGAESENGGRPPGRGGRGR--------GLVRKKLWPDED


                         .         .         .         +         .         .         .:280
query           DGPWTHDLHESVNEGPPPASxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09405         DGKWTHDLFEEMNDEQRPKS--------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09405         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09405         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09405         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09405         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09405         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09405         ----------------------------------------------------