[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_02520

[Show Plain Result]


## Summary of Sequence Search
    1::424
    2::291     2e-78  48%  296 aa  PF03095 PTPA "Phosphotyrosyl phosphate activator (PTPA) protein"
    1::424

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPVPRILSP
PF03095         --------------------------------------------------------------PVKRILSP


                         .         .         *         .         .         .         .:140
query           QDLETFLSSPAHSLIIAFVFNXXXXXXXXXXXXXXXXXXXETIRKVLSILSAIEELIDKHPSLDQNGSRF
PF03095         QDLEKFLRSPAYADIIAFILQLSEAVVGKKLSDEFPVS--ENVRKLLELLDKLESLIDEIPPDDQP-SRF


                         +         .         .         .         .         *         .:210
query           GNPAFRDLFDDIAAHSVQWHKDILGLDDPAAIEEVSTYLIHSLGSRSRLDFGSGHELNFMMWLLCLYLFG
PF03095         GNKAFRTWHDRLEERADSLLEELLPTELETALEELAAYLLESFGNSTRIDYGTGHELSFLAFLCCLFKLG


                         .         .         .         +         .         .         .:280
query           MLDRNDFPVIVCHVFIRYMKLMRHVQTTYYLEPAGSHGVWGLDDYHFIPFLFGAAQLTGHPYITPLAIHN
PF03095         ILDEEDERAIVLLVFARYLELVRRLQKTYTLEPAGSHGVWGLDDYHFLPFIFGAAQLI-HPIFKPKSIHD


                         .         *         .         .         .         .         +:350
query           NVVLDEEGDNWIYLDQVRWVDSVKTVKGLRWHSPMLDDISGAKNWYKVEAGMKKMFVKEVLGKLPIMQHF
PF03095         EEIVEEYRDEYLYFSCIGFINKVKT-GPFAEHSPMLYDISGVKSWSKINSGLIKMYKAEVLSKFPVVQHF


                         .         .         .         .         *         .         .:420
query           LFGSLIPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03095         LFGSLLP---------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxx
PF03095         ----