[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_02554

[Show Plain Result]


## Summary of Sequence Search
    1::149
    8::66      4e-06  38%   66 aa  PF01176 eIF-1a "Translation initiation factor 1A / IF-1"
    1::149

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQVVKMLGNGRLEALCFDGEKRLAHIRGKLRKKVW
PF01176         ------------------------------------RVTEALGNAMFRVELENGHEVLAHISGKMRRNIW


                         .         .         *         .         .         .         .:140
query           INQGDIILLSLRDYQDEKGDVILKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01176         ILPGDKVLVELSPYDLTKGRIIYR----------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxx
PF01176         ---------