[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_02566

[Show Plain Result]


## Summary of Sequence Search
    1::287
    8::185     2e-22  46%  206 aa  PF02230 Abhydrolase_2 "Phospholipase/Carboxylesterase"
    1::287

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxPHTHTAIFLHGRGSNGPEFTEDLFSSKTSGGQDLPSLFPSWRWVFPSS
PF02230         ----------------------PHTATVILLHGLGDNGDDLA--LLAEALA--------LPEVKFVFPRA


                         .         .         *         .         .         .         .:140
query           GSRWNATFMEHQSAWFDIASLADTNRRQDLQIQGLKESSQYVLGVIEREIELLGGRSDNIIFGGLSQGMA
PF02230         PTR--PVTINGGMAWFDIYSL-DPDGPED--EEGLDASAELVAALIDEEIA-YGIDPERIVLGGFSQGGA


                         +         .         .         .         .         *         .:210
query           TALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFD
PF02230         MALHLALRYPEKLAG----VVALSGWLPL-----------------------------------------


                         .         .         .         +         .         .         .:280
query           SKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQACQLLKEMGMDVKFYEYxxxxxxxxxxxxxxxxxxxxx
PF02230         --PEELKEALSTPVLLIHGTDDPVVPVELGEEAAELLKEAGANVTFKEY---------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxx
PF02230         -------