[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_02911

[Show Plain Result]


## Summary of Sequence Search
    1::537
    3::58      8e-12  43%   79 aa  PF10382 DUF2439 "Protein of unknown function (DUF2439)"
    1::537

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxFSCLFTYDIKRKAKRWQDGFLRFHTFNRRVMVYGTSGDFVGDLH
PF10382         --------------------------FTVLYTKQKTKKHKTWHDGYLKLHTFNNRVMLYDEDGKLLGSTF


                         .         .         *         .         .         .         .:140
query           MRESSTVRDGDQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10382         LNNSEDVQDGDE----------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10382         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10382         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10382         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10382         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10382         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10382         -----------------------------------------------