[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_02920

[Show Plain Result]


## Summary of Sequence Search
    1::1547
  130::394     7e-05  26%  794 aa  PF01576 Myosin_tail_1 "Myosin tail"
    3::237     1e-04  25%  311 aa  PF00038 Filament "Intermediate filament protein"
   39::158     6e-04  32%  668 aa  PF05557 MAD "Mitotic checkpoint protein"
   50::333     6e-04  26%  385 aa  PF10267 Tmemb_cc2 "Predicted transmembrane and coiled-coil 2
   20::92      6e-04  49%  132 aa  PF08359 TetR_C_4 "YsiA-like protein, C-terminal region"
  594::736     0.001  29% 1179 aa  PF12128 DUF3584 "Protein of unknown function (DUF3584)"
    3::73      0.001  31%  107 aa  PF06156 DUF972 "Protein of unknown function (DUF972)"
    1::1547

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQLFTLNTSSPAQAKRALEAHLAET
PF01576         --------------------------------------------------------------LKAKLDEL
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         ----------------------------------------------QVFEKKNQKSAQTIAQLQKKLEQY
PF08359         ------------------------------------------------------SPLEKLRALETHL---
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ERRLEETSNLGTALIEQQRELMDKLKEVEQQHTDGEIGPDLRRKLNDLEREYNEIGRETARVALGPKVRL
PF01576         ERQLNDLTAQKARLQAENSELSRQLEEAESQVSQLSRGKSLESQLEELKRQLEEETR--AKNALAHALRQ
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         HRRLKELEQNGS-----HRQPKDVLRDMGQGLKD--VGANIKGGLSGLSQAVVSKPREFARNKFGSADNI
PF08359         -RLLEE--NPGLAIVTQL--------ELRQSN------PELREEINELLRRYLQILDEIIE---------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TGQEDGLATPSLDSRHHASPSVFSSQATNSPSKVTVPSRKQRNQPSSRVHDIEFATEISTSXXXXXXXXX
PF01576         LEHELDLLREQLEEEQEAKAEL-ERQLSKANSELAQWKKKYETEAIQRTE--------------------
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         AHLKDSLE----EGGGESAPRNLSGSAT----LVSSPKYGSDDECSS-------ATSSSAGAGSNKGGGS
PF08359         EGQEQGEFRPDLDVR-------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXEREEAIKALTLEKSHLELEAEGFTQRLRALDESEQRYKDENWSLETQTHDLLAAAKEASDRESRLT
PF01576         ----ELEEAKKKLAQRLQEAEEQLEEANAKCASLEKTKQRLQQELEDLMVDLERANAAAAELEKKQRKFD
PF00038         ----------------------------EELQNLNDRLASYIEKVRFLEQQNKKLEAKIRELREKKGREV
PF05557         ---------------ERAQLELEKE-----LRDLQERADADFKKNQELEARLKRL---RKREEELEEELD
PF10267         SGASEQHGVLDALLEELREIK-------ETQSRLEESIERLKEQ---LQREYSLLTQALQEERYRYERLE
PF08359         ----------------------------------------------------------------------
PF12128         ------EAALQSAQEEQEELEKQLKAINKEIREITEAEEQARDDLKRLKNELEELKKKAEEAKERKQELE
PF06156         -----------------------------------------------------------------KKELF


                         .         *         .         .         .         .         +:350
query           SNLNALTVEKNNIQRELDELKQANGRLVEENMATQKALDSELHILRRNITLGESERNALQQKVDELAGQN
PF01576         KVLAEWKQKVEELQAELEAAQKEARELSTELFKLKNALEEALEQLETL----ERENKNLQDELEDLTSQL
PF00038         SRLKSLEAELRDLRRQLDELTKEKARLYEEELALRQSLEAELNGLRKDLDEETLARVDLENKIESLKEEL
PF05557         EAQEELEQLKRKLEREKRRLQREKEQLLEEAREEQSQLKNELEELKREAQDLERQLKSLEEELEELKEQL
PF10267         EQLNDLTLHQNEIANLKQELASMEEKVAYQSYERARDIQEALESCQTRISKMEQQQ---QQQVVQLEGLE
PF08359         ----------------------------------------------------------------------
PF12128         EQLNALEAELKQLKEELEELLEEQKEQLNELRNEKKALDNQLEQIKAEI---EAERQEAKERLKEL----
PF06156         DSVSSLEEQIGQLYKELGELKQHLAELLEENTALK--IENE-HLRERLEELEEEEKQKEQKKAEKKIGE-


                         .         .         .         .         *         .         .:420
query           QELAKAVAAKLRQHEADSAKDPNPEDNRKASDDLXXXXXXXXXXXXXXXRHGLLESETLKSSLHHAHRMI
PF01576         GEGGKSV---------------------------------------------------------------
PF00038         DFLKKNHEEEIKELQAQIQGSVNVEMDAARKPDLTAALREIRAQYEEIAEKNRQEAEAYQSKVEELQQQA
PF05557         EEL-------------------------------------------------------------------
PF10267         NANARALLGKL-----------------------------------------------------------
PF08359         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           QTLKGTIHREKTEKIELKRMLQDARDELEQRRAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01576         ----------------------------------------------------------------------
PF00038         ERNSEALRSAKEEITELRRQLQSLEAELESLKAQ------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         ----------------------------------------------------------------------
PF08359         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01576         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         ----------------------------------------------------------------------
PF08359         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01576         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         ----------------------------------------------------------------------
PF08359         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01576         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         ----------------------------------------------------------------------
PF08359         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01576         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         ----------------------------------------------------------------------
PF08359         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01576         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         ----------------------------------------------------------------------
PF08359         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01576         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         ----------------------------------------------------------------------
PF08359         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01576         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         ----------------------------------------------------------------------
PF08359         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01576         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         ----------------------------------------------------------------------
PF08359         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01576         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         ----------------------------------------------------------------------
PF08359         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01576         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         ----------------------------------------------------------------------
PF08359         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01576         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         ----------------------------------------------------------------------
PF08359         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01576         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         ----------------------------------------------------------------------
PF08359         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01576         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         ----------------------------------------------------------------------
PF08359         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01576         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         ----------------------------------------------------------------------
PF08359         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01576         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05557         ----------------------------------------------------------------------
PF10267         ----------------------------------------------------------------------
PF08359         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF06156         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           xxxxxxx
PF01576         -------
PF00038         -------
PF05557         -------
PF10267         -------
PF08359         -------
PF12128         -------
PF06156         -------