[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_02972

[Show Plain Result]


## Summary of Sequence Search
    1::134
    1::127     1e-31  50%  130 aa  PF06355 Aegerolysin "Aegerolysin"
    1::134

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxQQWVIVKITNSTNKALKIANLRLMYGKIHREGNKDEEISADDVDSTEIAPNATYTLCTCGRSDSPSG
PF06355         ---QQWVDIHIINNLGHGIKIRNAKLDWGKFYREGDKDDEISPDDVDGMVIPPGGTGDVCSCGREGAMSG


                         .         .         *         .         .         .         .:140
query           AEGALQLMQEQAAVCTLYWDCPWGSKTNNFEVQDRNKQYVVSAEGWVREGGALGTAEVEVxxxx
PF06355         TEGSFDLYDGDAKICTLYWDNPWGGKSNKFSVTDSNAKYKVETGGW-SESGPLGTVTVTV----