[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_02989

[Show Plain Result]


## Summary of Sequence Search
    1::1343
   39::253     4e-18  25%  274 aa  PF00664 ABC_membrane "ABC transporter transmembrane region"
    1::123     2e-15  43%  123 aa  PF00005 ABC_tran "ABC transporter"
  454::526     5e-05  38%  536 aa  PF02463 SMC_N "RecF/RecN/SMC N terminal domain"
   45::257     1e-14  27%  274 aa  PF00664 ABC_membrane "ABC transporter transmembrane region"(query 820->1034)
    1::123     2e-14  42%  123 aa  PF00005 ABC_tran "ABC transporter"(query 1140->1267)
  453::527     1e-04  34%  536 aa  PF02463 SMC_N "RecF/RecN/SMC N terminal domain"(query 1237->1307)
    1::1343

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxTLSKYALYFVYLGIAEFVLIYTCTVGFIYTGEHIAQKIRERYLDAVLRQNIAFFDKLGAGEITTR
PF00664         -----TLYLLALLLLALAVLIALLLYLSFYLAARLGQRIRRDLRRRLFRKLLRLPLSFFDRNPTGELLSR
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ITADTNLIQDGISEKVGXXXXXXXXXXXXXXIGFIKYWKLTLICCSTVVAIVTIMGGASRFIIRFSKKNV
PF00664         LTNDVEAIDDLLGSTLPLLLQALLTLVGALILLFLLSWKLALVLLAVLPLLILLAALFGKRLRKLSRKEQ
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ESYGEGGTVAEEVLSSIRNATAFGTQEKLAKQYDAHLLEAQKWGTKLQMTIGIMVGGMMSIVFLNYGLGF
PF00664         EARSELNSVLEESLSGIRTVKAFGAEERELERFEEALDEYRKASLKAARLSALLSPLLQLLGALSLALVL
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           WMGSRFIVSGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         WLGGYLVLSG------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSTVIGLLERFYNPVGGSVLVD
PF00664         ----------------------------------------------------------------------
PF00005         -------------------------------------------------STLLRLLAGLLKPTSGKILLD
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GVDIQNLNLKWLRQQISLVSQEPTLFGTTIYNNIKQGLIGSPFELEPDQSVRQRIENAAKMANAHDFIMG
PF00664         ----------------------------------------------------------------------
PF00005         GV-ISPLELRKLR--IGYVFQDPALFPLTVRENIAFGLKNDEKLKEKKKEAKEEILEALERVGLLKFLYR
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           LPEKYETHVGERGFLLSGGQKQRIAIARAIVSDPKILLLDEATSALDTKSEGVVQAALDEASKGRTTIII
PF00664         ----------------------------------------------------------------------
PF00005         YPHE-----------LSGGQRQRVAIARALIKEPKVLLLDEPTS--------------------------
PF02463         --------------LLSGGEKSLTALALLFAIQKPFYVLDEVDAALDDANVQRVADLLKELSKNSQFIVI
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           AHRLSTIKTADNIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         THRPGTMELADRL---------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLMFLMLGIVMFFAYSIQGSLF
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         -------------------------------------------------LLLLALAVLIALLLYLSFYLA
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           AYCSEKLIYRARSKAFRSMLRQDIAFFDVDENSTGALTSFLSTETKHLSGISGVTLGTILMVTTTLAASM
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ARLGQRIRRDLRRRLFRKLLRLPLSFFD--RNPTGELLSRLTNDVEAIDDLLGSTLPLLLQALLTLVGAL
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           VVGLAIGWKLALVCISCVPVLLACGFYRFWILAAFQRRXXXXXXXXXXXXXXXXXXIRTVASLTREPDVS
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ILLFLLSWKLALVLLAVLPLLILLAALFGKRLRKLSRKEQEARSELNSVLEESLSGIRTVKAFGAEEREL
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           GTYHGQLVVQGKKSLVSILKSSTLYAASQSFMFFVLALGFWYGGTLLGKGEYTLxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ERFEEALDEYRKASLKAARLSALLSPLLQLLGALSLALVLWLGGYLVLSGELTV----------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxSTTIALLERFYDTLSGGVYVDGTDITRWNVSAYRSFLALVSQEPTLYQGSI
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         -------------------STLLRLLAGLLKPTSGKILLDGV-ISPLELRKLR--IGYVFQDPALFPHTV
PF02463         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           RDNILLGITEDDVPEEAIIEACKAANIYDFIMSLPDGFSTLVGSKGSMLSGGQKQRIAIARALIRDPKIL
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         RENIAFGLKNDEKAKEEILEALERVGLLKFLYRYPHE-----------LSGGQRQRVAIARALIKEPKVL
PF02463         ----------------------------------------------SLLSGGEKSLTALALLFAKPAPFY


                         .         .         .         *         .         .         .:1330
query           LLDEATSALDSESEKVVQVALDAAAKGRTTIAVAHRLSTIQKADVIYxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         LLDEPTS---------------------------------------------------------------
PF02463         VLDEVDAALDDANVQRVADLLKELSKNSQFIVITHRPGTMELADRLY-----------------------


                         .         +         .         .         .         .         *:1400
query           xxxxxxxxxxxxx
PF00664         -------------
PF00005         -------------
PF02463         -------------
PF00664         -------------
PF00005         -------------
PF02463         -------------